KEGG   Hevea brasiliensis (rubber tree): 110654250Help
Entry
110654250         CDS       T05150                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase 2-like
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
hbr  Hevea brasiliensis (rubber tree)
Pathway
hbr00620  Pyruvate metabolism
hbr00710  Carbon fixation in photosynthetic organisms
hbr01100  Metabolic pathways
hbr01200  Carbon metabolism
Module
hbr_M00168  CAM (Crassulacean acid metabolism), dark
hbr_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
hbr_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
hbr_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:hbr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    110654250
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    110654250
Enzymes [BR:hbr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     110654250
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 110654250
NCBI-ProteinID: XP_021665868
LinkDB All DBs
Position
Unknown
AA seq 965 aa AA seqDB search
MAARNLEKMTSIDAQLRLLAPRKVSEDDKLVEYDALLLDRFLDILQDLHGADIRETVQDC
YELSAEYEGKRDPQKLEELGKVLTSLDPGDSIVVTKSFSHMLNLANLAEEVQIAYRRRIK
LKKGDFVDENSATTESNIEETLKRLVVQLKKSPEEVFDALKNQTVDLVLTAHPTQSVRRS
LLQKHARIRNCLTQLYAKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM
SYFHETIWKGVPKFLRRVDTALKNLGINERLPYNAPLIQFSSWMGGDRDGNPRVTPEVTR
DVCLLARMMAANLYFSQIEDLMFELSMWRCNDELRVHADELHRSSRKDAKHYIEFWKQIP
PSEPYRVILGDVRDKLYNTRERSRHLLVNGISDIPEEATFTNVEQFLQPLELCYRSLCAC
GDRPIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVLDAITNHLGIGSYREWSEECR
QEWLLSELRGKRPLFGPDLPKTEEIADVLDTFHVIAELPADNFGAYIISMATAPSDVLAV
ELLQRECHVKQPLRVVPLFEKLADLEAAPAAVSRLFSIDWYRNRINGKQEVMIGYSDSGK
DAGRLSAAWQLYKSQEELVKVAKQFGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTIHG
SLRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMHPPVSPKPEWRALMDEMAIIATK
EYRSIVFQEPRFVEYFRLATPELEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQTRF
HLPVWLGFGAAFKHVIEKDVKNLHMLQEMYNQWPFFRVTIDLVEMVFAKGDPGIAALYDK
LLVSKELWPFGERLRANCEETKRLLLQIAGHKDLLEGDPYLKQRLRLRDAYITTLNVCQA
YTLKQIRDPDYHVTVRPHLSKEYMESSKPAAELVKLNPTSEYAPGLEDTLILTMKGIAAG
MQNTG
NT seq 2898 nt NT seq  +upstreamnt  +downstreamnt
atggctgctaggaatttggagaagatgacatcaattgatgcacagctcaggctattggca
cctcggaaggtttccgaggatgacaagttagttgagtatgatgctctgttattggaccga
tttcttgatatattgcaggatttgcatggagcagatatcagagaaacggttcaagattgt
tatgaactttccgctgagtatgaagggaagcgtgaccctcaaaagttggaggaacttggg
aaagtgctaacgagtttagatcctggggattcaattgttgttactaaatctttttctcac
atgcttaacttggccaacctggctgaggaagttcaaatcgcttataggcgaaggattaaa
ttaaagaagggagattttgttgatgagaactcagcaacaactgaatcaaatattgaagag
accctcaagaggcttgtggtgcaattaaagaagtccccagaagaagtttttgatgctctg
aagaaccagacagttgatttagtcttaaccgcacatcccactcaatctgttcgtagatct
ttgcttcaaaagcatgcaaggattcggaactgtttgactcagttgtatgctaaggacatt
actccagatgataagcaggaacttgatgaggccttacaaagggagatccaagctgcattc
cgcacagatgaaatccgaaggactcctccaactcctcaagatgagatgagagctggaatg
agctacttccatgagacaatttggaagggtgtcccaaaattcttgcgccgtgtcgacaca
gctttgaagaatcttgggataaatgaacgtctaccttataatgctcctctcatccaattc
tcttcttggatgggtggtgatcgtgatggaaatcctcgagtaactcctgaagttacaagg
gatgtttgcttactggctagaatgatggctgccaacttatatttctcccaaatagaggat
cttatgtttgagttgtcaatgtggcgatgcaatgacgaacttcgtgttcatgcggatgaa
cttcatcggtcttcaaggaaagatgcaaaacactacatagaattttggaaacagattcct
ccaagtgaaccttatcgtgttattctcggtgatgtgagggacaaactttataatacacgt
gaacgctctcgtcatttattagtcaatggtatttctgacattcctgaggaagcgactttt
actaatgttgagcagttcttgcagcctcttgaactctgttacagatcactctgtgcttgt
ggtgatcgacctattgcagatggaagccttcttgatttcctacggcaagtttctaccttt
gggctttcccttgtaagacttgatatccgacaggaatctgacaggcatactgatgttctt
gatgctattacaaatcatttggggattggatcttatcgagaatggtctgaggaatgcagg
caggaatggctcttatctgagctcagaggcaagcgtcccctttttggccctgatcttcct
aaaacggaggaaattgctgatgtattagacacatttcatgtcattgcggaacttcctgca
gacaactttggtgcctatataatttcaatggctacagcaccatctgatgtacttgctgtt
gagcttttacagcgtgaatgtcatgtcaagcagccattgagggttgttccattgtttgag
aagcttgctgatcttgaagctgctcctgctgctgtttctcgtcttttctcaatagattgg
tatagaaaccggatcaatgggaagcaagaagtcatgatagggtactcggattctggaaag
gatgctgggcgtctctctgctgcttggcagctatataaatctcaggaagagcttgtgaag
gtggcaaagcagtttggggtgaagctaacaatgttccatggccgaggagggacagtcgga
agaggaggagggcccactcatcttgctatcttatctcaaccacctgacaccatccatgga
tcacttcgtgtgacagttcaaggtgaagttattgaacagtcttttggggaagaacacttg
tgtttcagaacactccagcgttttacagcagccacacttgaacatggaatgcatccccct
gtctcaccaaagccagaatggcgtgcacttatggatgagatggcaattattgccaccaag
gaatatcgttccatagtctttcaagaaccccgttttgtggaatactttcgccttgcaacg
ccagagttggagtatggtcggatgaacattggaagtagaccatctaaaaggaagccaagt
ggtgggattgaatcactccgagcaatcccttggatctttgcatggactcagacaaggttt
catctgcctgtctggcttggctttggggcagcatttaagcatgtcattgagaaggatgta
aagaatcttcacatgcttcaggaaatgtacaatcaatggcctttctttagggtcacaatt
gacttggttgagatggtgtttgccaagggtgatccaggaattgctgcgttatatgacaag
cttctagtatccaaagaattgtggccttttggagagcgcttgagagcgaactgtgaagaa
accaagcgccttctcctacagatcgctggtcataaagatcttcttgaaggagacccatac
ctgaagcaaaggcttcgacttcgtgatgcctatatcacaacacttaatgtctgccaagct
tacactttgaagcagattcgtgatcctgactaccatgtaacagtaagaccacacttatca
aaagaatacatggaatcaagcaaaccagctgcggagcttgtcaagcttaaccctactagc
gagtatgctcctggtctggaagataccctcattttgaccatgaagggtattgctgctggc
atgcaaaacactggttaa

DBGET integrated database retrieval system