KEGG   Hevea brasiliensis (rubber tree): 110658998Help
Entry
110658998         CDS       T05150                                 

Definition
(RefSeq) DNA ligase 6
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
hbr  Hevea brasiliensis (rubber tree)
Pathway
hbr03030  DNA replication
hbr03410  Base excision repair
hbr03420  Nucleotide excision repair
hbr03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:hbr00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    110658998
   03410 Base excision repair
    110658998
   03420 Nucleotide excision repair
    110658998
   03430 Mismatch repair
    110658998
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hbr03032]
    110658998
   03400 DNA repair and recombination proteins [BR:hbr03400]
    110658998
Enzymes [BR:hbr01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     110658998
    6.5.1.6  DNA ligase (ATP or NAD+)
     110658998
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     110658998
DNA replication proteins [BR:hbr03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    110658998
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     110658998
DNA repair and recombination proteins [BR:hbr03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     110658998
   NER (nucleotide excision repair)
    Other NER factors
     110658998
   MMR (mismatch excision repair)
    Other MMR factors
     110658998
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DRMBL DNA_ligase_A_C UBA_4 RMMBL Lactamase_B_2
Motif
Other DBs
NCBI-GeneID: 110658998
NCBI-ProteinID: XP_021672507
LinkDB All DBs
Position
Unknown
AA seq 1405 aa AA seqDB search
MEACKSTKEKHKTLDSLHLYHTSLASLSLPIPPHDQPFSLPLPSSLPLSKLIPNTRFLVD
AFRFSTTSSVTYFLSHFHSDHYTGLSSNWSQGLIFCSPTTANLLTLVLKIPSQFVFPLPL
LKPVIIDGSEVALVDANHCPGAVQFLFKVPGKNQESFEMYIHTGDFRYSGSMKENSLLSQ
FVGCDAIFLDTTYCHPKYVFPSQGESIDHMVSVIKRIGGEFTSQEKKVLFLVATYVVGKE
RILLEIAQRCKRKVHVDGRKMEVLRVLGYGESGIFTEDGSESDVHVVGWNVLGETWPYFR
PNFVRMNEIMVERGYSKVVGFVPTGWTYEVKHNKFSVRSKDSFEIHLVPYSEHSNYDELR
EYVKFLRPKRVIPTVGVDIEKIDSRHAIKMQKHFAGLVDEMANKKEFLMGFHSGSCENDE
NTRMEDVLELKEGLDQEKEVKSSEVKALEDEDADFKNSSSTQQEPCSQNLTIPNDEETEK
LMQELGDSLPSWVTRDQKLDLIRSSGGNFVDAVSNFYERETEFHQQVFPYKTSASSSQTD
SLHESESPSNPVSIKSSQESSGITPLNQNYVSSSLKSSSKSSLTPGKRKRNVGKKAKTNS
KLESGGPKQSSITRFFSKLAPDAHCSVVRFIPDQSTEENSTQNDGTKSYKEEIDRFIQIT
DLNESSRGYATTILKRTKGDINKALDMHYGNPEGNFDDSVENLAASDNLVQPQYDINECS
CAQEKTVSEEGKNMVDPSIQRSLTENVAVAHVALPVEKYNPVQHACWSVGEPAPYIHLAR
TFDLVEAEKGKIKATSMLCNMFRSLLALSPEDVLPAVYLCTNKIAADHENIELNIGGGLV
TSSLEEACGAKRSKIRDMYNSFGDLGDVAQVCRQTQTLLAPPPHLLIKDVFSVLQKISVQ
TGTGSTVRKKSLIVNLMRSCREKEMKFIVRTLVRNLRIGAMMRTVLPALAQAVAMNSLVN
SSDEQKAESLKEKLQYLSTAVVEVYNILPDLDLIVPSLISKGIEFSSSTLSMVPGVPIKP
MLAKITNGVSQALKLFQDKAFTCEYKYDGQRAQIHKLPNGTLRVFSRNGDETTSRFPDLI
NIMKESCKSAAVTFIVDAEVVAVDRKNGCKLMSFQELSSRERGSKDSFIAMNDIKIEICV
FVFDIMFANGEHLLGLPLRQRRKCLKDLFCDERMGYFEYAKEMTVEAHYSCLTNNVTITK
INSFLEDALHSSCEGIMVKSLDVHAEYSPSKRTDTWLKVKRDYVEGLNDSLDLVPIGAWH
GNGRKAGWYSPFLMACYNPETEDFQSVCRVMSGFSDAFYTKVKEFFSEDKILLKKPSYYQ
TSEVPDLWFSPELVWAIRGADLTVSPVHHAAIGLVHPSRGISMRFPRFICSVSDRNAEEC
STAADIAEMFNSQTRKMNVTGTATN
NT seq 4218 nt NT seq  +upstreamnt  +downstreamnt
atggaagcctgcaaatccaccaaggaaaaacacaaaaccctagattctctccacctttac
cacacctctcttgcttccctttccctcccaatccctccacatgaccaacccttctctctc
cctctcccctcctctctccccctctccaagctcatacccaatacccgcttcctcgtcgac
gcatttcgcttctccaccacctcctccgttacctacttcctttcccatttccactccgac
cattacacgggtctttcgtctaattggtcccaaggcctcattttctgctctcccactaca
gccaatctcctcaccctagtcctcaaaattccctcgcagttcgtctttccattgcctctg
ctcaagcccgtgattatcgatggctctgaagttgcattagttgatgctaatcactgcccg
ggggcggtacagttcttgtttaaggttcccggtaagaatcaagaaagttttgaaatgtat
attcacactggtgattttagatacagtggttcgatgaaagagaatagcctattgagccaa
tttgttggttgtgatgcgattttcttggatactacttattgtcatcctaaatacgttttt
ccctcgcaaggggagtctattgatcatatggttagtgttatcaagagaataggtggggag
tttacgagtcaagaaaagaaagtgttgtttcttgttgccacatatgtggttgggaaggag
aggattttgcttgagattgcgcaaaggtgtaaaagaaaggtgcatgtggatgggaggaaa
atggaggttttgcgggttttggggtatggggagagtgggatatttacagaggatgggagt
gaaagtgatgttcatgttgttgggtggaacgtgttgggagagacgtggccttactttcgg
ccgaattttgttagaatgaatgagataatggtggaaagagggtattctaaggttgtggga
tttgtgccaactggatggacttatgaagtgaagcataataaattctcagtcaggtcaaag
gattcatttgagatccatcttgtgccatatagtgagcattcaaattatgatgagcttaga
gagtatgtgaagttcttgagacctaagcgtgtcattcctacagttggtgtggatattgaa
aaaattgatagcaggcatgctattaaaatgcagaaacattttgctggtttagttgatgaa
atggctaacaagaaagaatttttgatgggctttcatagtgggtcatgtgagaatgatgaa
aacactagaatggaagatgtcttagagttgaaggagggcctggatcaggagaaagaggtg
aagtcatctgaagtgaaagcccttgaagacgaggatgcagattttaaaaactcttcatct
actcagcaagaaccttgttctcaaaatttaactataccaaatgatgaagaaacagaaaaa
ctaatgcaagaacttggtgattctttgccctcatgggttactcgggaccaaaagttagat
ttgattagaagctcaggggggaattttgttgatgcagtttcaaatttttatgaacgtgaa
acagaatttcatcaacaagtctttccttataagacatctgcgtcttcttctcagactgat
tcactccatgaatctgaatcgccttcaaatccagtttctatcaagagcagtcaagagagt
tcaggtattacacctttaaatcaaaactatgtgtcatcaagcttaaagtcttcaagcaag
agtagcttgactcctggaaaaaggaagaggaacgttggcaagaaagcaaaaacgaattcc
aaactggaatctggtgggccaaagcagtctagtattacaaggttcttcagtaaacttgct
cctgatgctcattgtagtgtggtccggttcatacctgatcaatctacagaagaaaattca
acgcagaatgatggtacaaaatcatacaaagaggagatagatcggtttattcagataacc
gaccttaatgaatcatcaagaggctatgctaccactatcctgaagaggaccaaaggagac
attaacaaggcattagatatgcattatggtaatccggagggtaactttgatgacagtgta
gagaacttggcagcatcagacaatttggttcagcctcagtacgatattaatgagtgctct
tgtgcccaggaaaaaactgtatcagaagagggaaagaatatggttgatccttccatacag
agatcattgacagaaaatgtggctgtagctcatgttgcactaccagtagaaaaatacaat
cctgtacaacatgcatgctggagtgttggagagcctgctccatatatccatcttgcacga
acatttgacctggttgaggctgaaaaaggaaagatcaaagctacttccatgttgtgcaac
atgttcagaagtttgctagcgttgtctcctgaggatgtgctacccgctgtgtatctgtgc
acaaacaagattgctgctgaccatgaaaacatagagctcaatattggtggaggcttagtc
acttcatcattagaagaggcatgtggggcaaagcggtctaaaataagggatatgtacaat
agttttggggatcttggtgatgttgctcaagtgtgccgacaaacacagacattacttgct
cctcctcctcaccttcttataaaagatgttttttctgttctccaaaagataagtgtgcag
acaggtactggaagcactgttcgaaagaagagcctcattgtaaatctcatgcgttcatgc
agggagaaggagatgaagtttattgtcagaactttggtaagaaacttacggattggagca
atgatgagaactgttctacctgcattggctcaagctgttgctatgaattccttggttaat
tcttctgatgaacaaaaagctgaaagtttgaaggagaaactccagtacctatccacggca
gttgttgaagtgtataatatacttccagatttggatttgatcgttccctctctcataagt
aaaggcattgaattttcatcatcaactttgtcaatggtgccaggcgtacctattaaaccc
atgcttgcaaaaattacaaacggagtttcccaagcactgaaactctttcaagataaagct
tttacatgtgaatacaaatacgatggtcagcgtgcccaaattcacaaactaccaaatggc
actttgcgtgtattttcacgaaacggggatgaaacaacatcaagatttccggatttgatc
aatataatgaaggaatcttgtaaatctgctgcagtgactttcatagtggatgcagaggta
gttgcagttgatagaaaaaatggctgcaagctcatgtcgttccaagaactatcatcaagg
gagagagggagcaaagattcctttatcgcaatgaatgatataaagatcgagatttgtgta
tttgtctttgacatcatgtttgctaatggagaacacctgctggggctccctcttcgccaa
agaaggaaatgcctaaaggatttgttttgtgatgagaggatgggctattttgagtatgca
aaggaaatgacggttgaagcacattattcttgtttgaccaataacgtaacaataaccaag
ataaactctttccttgaagatgcattgcattcctcatgtgaaggaattatggtgaaatct
ttagatgttcatgcggaatattctccatcaaaacgtaccgacacatggctgaaggtcaag
cgagattatgtggaaggactgaatgactcgcttgatttagtccctattggtgcttggcat
gggaatgggagaaaagcaggatggtatagtccatttctcatggcatgttacaaccctgag
actgaggactttcagagtgtttgccgtgtcatgtctgggttctcagatgcattttacact
aaggtgaaagagttcttttctgaagataagattttgttgaaaaagccgtcttactaccaa
acttccgaggtgccagatttgtggttttctccagaacttgtttgggcaatacgtggtgca
gacttgacagtttcaccagttcaccatgctgctataggtttagttcatccatcccgtggc
atctcaatgagatttccaagatttatctgctctgtgtcagatagaaatgcagaggaatgt
agcacagctgcagatattgcagaaatgtttaattctcaaacgcggaagatgaatgtaaca
ggcacagctaccaattaa

DBGET integrated database retrieval system