KEGG   Hevea brasiliensis (rubber tree): 110659134Help
Entry
110659134         CDS       T05150                                 

Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
hbr  Hevea brasiliensis (rubber tree)
Pathway
hbr03030  DNA replication
hbr03410  Base excision repair
hbr03420  Nucleotide excision repair
hbr03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:hbr00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    110659134
   03410 Base excision repair
    110659134
   03420 Nucleotide excision repair
    110659134
   03430 Mismatch repair
    110659134
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hbr03032]
    110659134
   03400 DNA repair and recombination proteins [BR:hbr03400]
    110659134
Enzymes [BR:hbr01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     110659134
    6.5.1.6  DNA ligase (ATP or NAD+)
     110659134
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     110659134
DNA replication proteins [BR:hbr03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    110659134
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     110659134
DNA repair and recombination proteins [BR:hbr03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     110659134
   NER (nucleotide excision repair)
    Other NER factors
     110659134
   MMR (mismatch excision repair)
    Other MMR factors
     110659134
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 110659134
NCBI-ProteinID: XP_021672689
LinkDB All DBs
Position
Unknown
AA seq 814 aa AA seqDB search
MLALRSCSSLLFISFSHRSNSFSSLLFCFPFSKSSFLPNPPHLFVKLSPQSTMSSRPSAF
DTLMSNARAAAKKKSQSQSSPPKKRKSPDSRNPTKTLSSVEAEAPSNPPIPDSKVSQDET
NKSKVDKKMVNKPQIPGSENPSLSFVKLGQERVINSKKQRVEIADLKSKIESLKKSPGDF
DPKKVLSWEKGERVPFIFVCLGFELIEKESGRILITNMVCNMLRTVMDTTPDDLLALVYL
LANKVAPAHEGVELGIGESIIIKALAEAFGRTEKQVKKQLEGTGDLGLVAQASRSSQSMM
RKPDALTIAKVFNTFRLIAKESGKDSQDKKKNHIKALLVAATDCEPLYLIRLLQGKLRIS
LAGQTLLAALGQAAVYTEKNCTPPSHIQSPLDEAAKIVKQVYSVLPVYDKIVPALLSDGV
WNLPKSCSFTPGVPIGPMLAKSIKKVSEIADKFQNMDFTCEYKYDGERAQIHYLENGSVE
IYSRNAERNTGKYPDVIVTISRLKKGPVKSFVLDCEIVAYNREEKQILPFQILSSRPRKN
VVMSDIKVNVCIFAFDMLYLNGEPLIQKQLEVRRQRLYDSFEEDPGYFQFATAVTSNDLE
EIQTFLGAAVDASCEGLIIKTLNKDATYEPSKRSLNWLKLKKDYMDNIGDSLDLVPIAAF
HGRGKRAGVYGAFLLACYDKDNEEYQSICKIGTGFSEQVLEDLSNGLRSKVIPKPKPYYR
HGDKINPDVWFEPSEVWEVKAADLTISPVYSAALGKAERDKGVSLRFPRLVRVRTDKSPE
EATTSNQVAEMYDAQKPNQPNNNQAKNQDDSEDD
NT seq 2445 nt NT seq  +upstreamnt  +downstreamnt
atgctcgctctccgttcatgctcttctctgctattcatttccttttctcatcgctccaat
tctttctcttctctccttttctgctttcccttctctaaatcttcctttcttcctaatcct
cctcatctctttgtcaaattgagtcctcagtccacaatgtcttctcgcccatccgctttc
gacaccctcatgtcaaatgcgcgcgccgccgccaaaaaaaaatcacagtcacaatcctcc
ccacccaagaaacgcaaaagccctgattcccgaaaccctactaaaaccctcagttccgtt
gaagcagaagctccgtcgaatccccctatccctgattcaaaagtttctcaagatgaaaca
aacaagtccaaagtagacaaaaaaatggtaaataagccccaaatccctggctcggaaaac
cctagtttatctttcgttaaattgggtcaagaaagagttattaatagcaagaaacaacgt
gtggaaattgcggacttgaagagtaagattgagtcattgaagaagagtcccggggatttt
gaccccaaaaaagtgttgtcttgggagaagggcgagagggttccttttatatttgtctgt
ttgggttttgagttgattgaaaaagagagcgggaggattttgatcactaatatggtgtgc
aatatgttgagaactgtaatggatacgacgcctgacgatttgctagcattggtatatctt
ttggctaacaaggttgcgcctgcgcatgagggagtggagctgggaattggagaatcaatc
attatcaaagcacttgctgaggcgtttgggaggactgagaagcaagtcaagaagcaatta
gagggaacgggagatttaggacttgttgctcaagcaagccgctcatcacaatctatgatg
cgcaagcctgatgcgttaacgattgccaaagttttcaatacatttcggctgattgccaag
gaatctgggaaggatagtcaagataagaaaaagaaccatatcaaggcacttcttgttgca
gccactgactgtgaacctctatatctaattcgtctgcttcagggaaagctgcgaattagt
ttggcaggacagactcttttggctgcactgggacaagctgctgtatatactgaaaaaaat
tgcactccaccttcacacatccagtctcctttagatgaggctgcaaagattgttaaacaa
gtctactctgtacttcctgtgtatgataaaatagtccctgctcttcttagtgatggtgta
tggaatcttcccaagtcatgtagctttacgcctggtgtccccattggaccaatgcttgca
aagtcaatcaaaaaggtttctgagatagcagataagttccagaatatggacttcacttgt
gaatacaagtatgatggagagcgtgcccagatacattacctggagaatggttcagtcgag
atatacagtcgaaacgctgagcggaatactggaaaatatccagatgttatagttacgatt
tcaagattaaagaagggacctgtaaaatcatttgttttggactgtgaaatagttgcttac
aaccgagaggaaaaacaaattctgccctttcagatccttagtagtcggccccgcaaaaat
gttgtgatgagtgacatcaaggttaatgtttgcatatttgcatttgatatgttgtatctt
aatggcgaaccacttattcagaaacaattagaagttcgtagacagcggctttatgactca
tttgaggaagaccctggatattttcagtttgcaacagctgtaacatcaaatgatcttgag
gaaattcaaacgttccttggtgctgctgttgatgctagttgtgagggtttaatcatcaaa
acattgaacaaagatgccacatatgagccttccaagcgatcgctgaactggctaaaattg
aagaaagattacatggacaacattggggactcgctggatcttgtacctattgctgctttc
catggtcgtgggaaacgtgcaggtgtctatggtgcttttcttctcgcttgttacgacaaa
gataatgaagagtaccaaagcatatgtaaaataggaactggattttctgagcaagtgctt
gaagatctctctaatgggcttcgttctaaagtgattcctaaaccaaagccatactatagg
catggtgataaaattaatccagatgtgtggtttgagcccagtgaggtatgggaggtgaaa
gctgcagacttgactattagccctgtttatagtgctgcacttggcaaagcggaaagagac
aagggtgtttcgctgcgattcccacgactagtaagagtccggacggacaagtctccagag
gaagccacaacatctaatcaggttgctgagatgtatgatgctcaaaagcctaatcaacca
aacaataatcaagcgaaaaatcaagatgacagtgaagatgattga

DBGET integrated database retrieval system