KEGG   Hevea brasiliensis (rubber tree): 110660240Help
Entry
110660240         CDS       T05150                                 

Definition
(RefSeq) UMP-CMP kinase 3-like
  KO
K13800  UMP-CMP kinase [EC:2.7.4.14]
Organism
hbr  Hevea brasiliensis (rubber tree)
Pathway
hbr00240  Pyrimidine metabolism
hbr01100  Metabolic pathways
Module
hbr_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:hbr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    110660240
Enzymes [BR:hbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.14  UMP/CMP kinase
     110660240
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADK AAA_17 AAA_33 AAA_18 Thymidylate_kin AAA_28 AAA Ploopntkinase3 Cytidylate_kin SRP54 AAA_19 Hydin_ADK
Motif
Other DBs
NCBI-GeneID: 110660240
NCBI-ProteinID: XP_021674163
LinkDB All DBs
Position
Unknown
AA seq 291 aa AA seqDB search
MGDMKEETSEMVIGEHAIETVSVDKTTNNEFVSENTTTELEFSEKETFDEILSENKTVES
VCEKETKEAVPEETAKETVTEKKLVVVFVLGGPGGGKTTQCAKVAKEFGFTHLSSGELLR
QRIKSDPENGPVIEAEMKEGESVAPDITMEELKKAMAKSENNKFILDGFPFDEETRATFE
AATNIQPELVLFFDCSEEERERRILSRKQQGRPDDNPETVRKRFKKFQKNTLPVVEYYRA
RGIVLQVDAGKLQEEVFKTLKSILDPSTKMQAEDQAPTIEELEREISELLL
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgggtgatatgaaggaggaaacaagtgaaatggtgattggagaacatgccattgagact
gtgagtgtggacaagacaacaaataatgaatttgtgtctgaaaatacaacaacagaattg
gagttctctgagaaagagacattcgatgagattttgtctgagaacaaaacagtggaaagt
gtttgtgagaaagaaacaaaagaggctgtgcctgaggagacagccaaggagactgtaaca
gagaaaaagcttgtagttgtatttgttttaggtggtcctggagggggaaagaccactcag
tgtgccaaggtagccaaagaatttgggtttacccatctcagcagcggagaacttcttcgc
cagagaattaaaagtgacccagaaaatggacctgtgattgaagccgagatgaaggaggga
gagagcgttgctccagacataacaatggaggaacttaagaaagctatggcaaaaagtgaa
aataataaatttattctggatggttttccttttgatgaggagactcgagctacttttgaa
gctgctaccaacatacaaccagaacttgtgctcttctttgattgttctgaggaagaaagg
gagagaagaattttaagcaggaaacagcagggaaggccagatgacaatcctgagactgta
aggaagcgatttaaaaaatttcagaagaatactcttcctgtcgttgagtattatagagca
agaggcatagttttgcaggttgatgctggaaagctacaggaggaagtgtttaagactctt
aaaagcattcttgacccctcaacaaagatgcaagctgaagatcaagcaccaaccattgaa
gaacttgaaagggaaatatcagaattattattataa

DBGET integrated database retrieval system