Hevea brasiliensis (rubber tree): 110661630 Help Entry 110661630         CDS       T05150                                  Name (RefSeq) calmodulin-7 isoform X1   KO K02183   calmodulin Organism hbr  Hevea brasiliensis (rubber tree) Pathway hbr04016   MAPK signaling pathway - plant hbr04070   Phosphatidylinositol signaling system hbr04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:hbr00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     110661630    04070 Phosphatidylinositol signaling system     110661630  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     110661630  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:hbr01009]     110661630   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hbr04131]     110661630    03036 Chromosome and associated proteins [BR:hbr03036]     110661630   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hbr04147]     110661630 Protein phosphatases and associated proteins [BR:hbr01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      110661630 Membrane trafficking [BR:hbr04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     110661630 Chromosome and associated proteins [BR:hbr03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      110661630 Exosome [BR:hbr04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    110661630 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EF-hand_4 SPARC_Ca_bdg EF-hand_11 UPF0154 DUF5580_M Dockerin_1 EFhand_Ca_insen RNA_pol_Rpb4 Caleosin Poly_export MotA_activ DUF6279 PA_Ig-like Fe_hyd_lg_C SurA_N_3 MecA_N Motif Other DBs NCBI-GeneID:  110661630 NCBI-ProteinID:  XP_021676000 LinkDB All DBs Position Unknown AA seq 149 aa AA seqDB search MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE EVDEMIREADVDGDGQINYEEFVKVMMAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggccgatcagctcaccgacgaccagatctctgagttcaaggaagccttcagcctcttt gataaggatggcgatggctgcattactactaaggaacttggcactgtaatgcgttcgctg gggcagaacccaactgaagcagagctccaggacatgataaatgaagttgatgctgatggg aatggtactattgatttcccggagttccttaatctgatggcccgtaagatgaaggacact gattctgaggaagagctcaaggaagctttccgggtttttgataaggatcagaatggcttc atttctgctgctgaacttcgccatgttatgacaaatcttggtgagaagctgacagatgag gaggttgatgagatgatccgtgaggccgatgtggatggtgatggacagatcaactatgag gagtttgtcaaagtcatgatggccaagtaa

DBGET integrated database retrieval system