KEGG   Hevea brasiliensis (rubber tree): 110665020Help
Entry
110665020         CDS       T05150                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, mitochondrial isoform X1
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
hbr  Hevea brasiliensis (rubber tree)
Pathway
hbr00020  Citrate cycle (TCA cycle)
hbr00190  Oxidative phosphorylation
hbr01100  Metabolic pathways
hbr01110  Biosynthesis of secondary metabolites
hbr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hbr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    110665020
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    110665020
Enzymes [BR:hbr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     110665020
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 110665020
NCBI-ProteinID: XP_021680659
LinkDB All DBs
Position
Unknown
AA seq 636 aa AA seqDB search
MWRFVARGLRLPPFSKKSISNDSLRTHISRFVSTESTGGRSSYTIVDHTYDAVVVGAGGA
GLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDW
LGDQDAIQYMCREAPKAVIELENYGLPFSRTEDGLIYQRAFGGQSLNFGKGGQAYRCACA
ADRTGHALLHTLYGQAMKHNTQFFVEYFALDLLMNSDGSCQGVIALNMEDGTLHRFRAAS
TILATGGYGRAYFSATSAHTCTGDGNAMVARAGLPLQDLEFVQFHPTGIYGAGCLITEGS
RGEGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYLHLNHL
PPDVLKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTVKGNDPDA
VVPGLMAAGEAACASVHGSNRLGANSLLDIVVFGRACASRVAEIQRPGFREKQKPLEKDA
GERTIAWLDKLRNSNGSMPTSQIRLNMQRIMQNNAAVFRTQETLEEGCQLIDRAWESFHD
IKLKDRSLIWNSDLIETIELENLLINACITMHSAEARKESRGAHAREDFTKRDDENWMKH
TLGYWEKEKVRLDYRPVHMNTLDDEVESFPPKARVY
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atgtggaggttcgttgcgcgtggccttcgccttcctcctttttctaagaaatccatctct
aatgactctcttagaactcacatttccagatttgtctctactgaatcgactggggggcga
tcctcatacaccattgttgatcatacatatgatgcagtggtcgtaggagcaggtggtgcc
gggttgagagctgccataggactctcagaacatggattcaatactgcttgcattaccaag
ctttttccaactcgttcacacaccgttgcagctcagggaggcatcaatgcagctttggga
aatatgacagaagatgattggagatggcacatgtatgacactgttaagggaagtgactgg
ttaggtgatcaggacgccattcaatacatgtgtagagaggcaccaaaggcagtcatagaa
cttgagaattatgggctaccattttcccgaacagaagatggactaatttatcagcgtgca
tttggtggtcagagtttaaattttggaaaaggtggacaagcgtatcgttgtgcatgtgct
gctgaccgaactgggcatgctcttttgcatactctctatggccaagctatgaaacataat
acacaattttttgtggaatattttgctttggatctacttatgaatagtgatggtagctgc
caaggagtaattgcattgaatatggaggatggaacgttacatagattccgtgctgcttca
actatcctggccacagggggttatggtagagcttacttttcagcaacctcagctcataca
tgcactggagatggcaatgctatggttgctagggctgggctcccactccaggacctggaa
tttgttcaatttcatcctacaggcatttatggagctggctgcctaattactgaaggttct
cgtggagaaggtggtattcttaggaacagtgaaggtgaacgatttatggaaagatatgct
cctacagccaaggatcttgcatcaagagatgttgtttcaagatctatgaccatggagatt
cgggagggtcgtggtgttgggcctttgaaggaccatatctatttgcatttaaatcacttg
cccccagatgtactaaaagaaaggcttcctggtatttctgaaactgctgccatttttgct
ggtgtggatgttacgaaggaacccatccctgtcttacctactgtgcattacaatatgggt
ggaattcccacaaattaccatggagaggtggtcaccgttaaaggcaatgatcctgatgct
gtagttcctggattgatggctgctggagaggcggcctgtgcatcagtgcatggttccaat
cggcttggtgcaaattctctgcttgacattgttgtttttggtcgagcttgtgcaagtaga
gtggcagagatccagagaccaggtttcagggagaaacagaagcctttggaaaaggatgct
ggcgagaggaccattgcatggctggacaaactgaggaattcaaatggatcaatgccaact
tcacaaattcggttaaatatgcagaggataatgcaaaataatgctgctgtgttccgtacg
caagaaactctggaagaaggttgccagctgatcgacagggcatgggagagctttcatgat
attaagttgaaagatcgcagtttaatatggaactctgacttgatagaaaccatagaactg
gaaaaccttttgataaatgcctgcatcacaatgcattctgctgaggctcggaaggagagc
agaggagcacatgcccgtgaagatttcactaaaagagatgatgagaactggatgaagcac
actttgggatattgggagaaggaaaaggtccgactcgattacaggccagtacacatgaat
acactagatgacgaggttgagtcattcccacctaaagctcgtgtctactga

DBGET integrated database retrieval system