KEGG   Hevea brasiliensis (rubber tree): 110668837Help
Entry
110668837         CDS       T05150                                 

Definition
(RefSeq) alpha-amylase-like
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
hbr  Hevea brasiliensis (rubber tree)
Pathway
hbr00500  Starch and sucrose metabolism
hbr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hbr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    110668837
Enzymes [BR:hbr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     110668837
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amyl_C2 Alpha-amylase Glyco_hydro_70 PHB_acc_N
Motif
Other DBs
NCBI-GeneID: 110668837
NCBI-ProteinID: XP_021685917
LinkDB All DBs
Position
Unknown
AA seq 428 aa AA seqDB search
MGVVGASLSFLLLTLALWTKATSTQILFQGFNWESWKKEGGWYNFLRNSIPELASSGITH
VWLPPSSHSVSAEGYLPGRLYDLNASQYGNQDDLKALVRALHKMGIQCIADIVINHRCAE
KQDDRGIWSIFEGGTPDDRLDWGPSFICSDDTLYSDGKGNPDTGADFNAAPDIDHINLRV
QRELSDWMNWLKNEIGFDGWRFDFARGYSPSFTKIYMANTKPSFAVGEIWKDLAYGNDGK
PEYNQDAHRLDIVEWIQAAGGDVTAFDFTTKGILQTAVGGELWRLNDSNGGPPGVIGLLP
GNGVTFIDNHDTGSTQNHWPFPSDKIMQGYAYILTHPGIPSIFYDHFFDWGLKEEISKLI
AVRTRNHIRPNSVMQILASDADLYMAVVDEKIIAKIGPRSDIGDLVPPTFQLAASGQDYS
VWEKKVIR
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtagttggtgcttcactttcctttcttctcttgacccttgccctctggacaaaa
gcaacctctactcagattttatttcaggggttcaattgggaatcatggaaaaaagaaggt
ggatggtacaactttttaagaaactctattcctgaattggctagttccggcattacacat
gtttggcttcctccatcttctcattctgtttcagctgaaggatatctacctggaaggctc
tatgatctcaatgcatcgcagtatggaaaccaagatgacctaaaagctttagtgagggcc
ttgcacaaaatggggattcagtgcatagcagacatagttataaaccatagatgtgcagag
aagcaagatgatagaggaatatggtcaatatttgaaggagggactccagatgatcgactt
gactgggggccatctttcatttgcagcgatgacactctttactctgatggaaaaggaaat
cctgacactggagctgacttcaatgctgctccagatattgatcatataaacctgcgggta
caaagggagctatctgattggatgaattggctaaagaatgaaattggttttgatgggtgg
cgatttgattttgcgagaggatattcaccaagttttactaaaatatacatggcaaacacc
aaaccaagttttgcagtgggggaaatatggaaagatcttgcttatggaaatgatggaaag
cctgaatacaaccaggatgctcatcggcttgacattgtggaatggatccaagctgctggt
ggagatgttacggcatttgacttcacaactaaaggaatactccaaacagcagttggaggt
gagctgtggcggttgaatgactcaaatggaggacctcctggagtgattggcttgttgcca
gggaatggtgtcactttcattgacaatcatgatacaggttccacacaaaatcattggcca
tttccatcagataaaatcatgcagggatatgcttatattctcacccatccagggatccca
tcaatattctatgatcacttttttgactggggtctgaaagaagagatttcaaagcttatt
gcagtcagaaccaggaaccatatcagacccaacagtgttatgcaaattctagcaagtgat
gccgatctctacatggctgttgtagatgagaagatcattgccaagattggaccaaggtct
gatattggggaccttgtccctccaacattccaacttgcagcttctggacaagattacagt
gtatgggagaaaaaagttataaggtaa

DBGET integrated database retrieval system