KEGG   Hyperthermus butylicus: Hbut_0351Help
Entry
Hbut_0351         CDS       T00468                                 

Definition
(GenBank) Formaldehyde:ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
hbu  Hyperthermus butylicus
Pathway
hbu00030  Pentose phosphate pathway
hbu01100  Metabolic pathways
hbu01120  Microbial metabolism in diverse environments
hbu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hbu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Hbut_0351
Enzymes [BR:hbu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Hbut_0351
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: ABM80223
UniProt: A2BJR2
LinkDB All DBs
Position
339808..341643
Genome map
AA seq 611 aa AA seqDB search
MASEKLFSWFKRILWVDLSRGEFREWRYPGEMARMFVGGRGYAIKILWDHLPEGADPLGP
DNLLILAVGPLTGLPGPSTGKMVVAAKSPLTGGYGDGNIGTRAAVNLRAAGWDAVVIRGV
ARKPSILVIEDDKAWLEPADDLWGLDTFRAADKLEERFGKTAGILLIGPGGENMVRYATI
VSQKGRSGGRPGMGAVMGSKKLKAIVVRGTKKPELFHPEEELRIGTEAIKFVKSSPNYEF
WMRQGTMMTIEWSQNASVLPTYNFREGVFDGWEGISGNYMEKVKVTTKSCPLCPMSCGHV
VKDAEGQPSELDYENVAMLGSNIGISRLEDAALLNRLADMYGIDTISLGNTLGYALEAAE
RGKLELDATWGETRKLAKLVEDIAYRRGVGDLLAEGVKRVSEKVGETWYAMHVKGLEVSA
YDCHAAPGMALSYATSPIGAHHKDAWVISWEVQHGRFKYGREKVLRVIELQRIRGGFFET
AVTCRFPFVELGLALDYYVKMFQAATGLSYSLEDHFTVADRIYTLIRLFWVREHGGWGIE
MDLPPERWFREPLTKGPLKGAKLDKDKFIEMLKIYYRERGWAENGVPLPETVKKLGLGED
AVRLAERYSSK
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atggctagcgagaagctcttctcctggttcaagcgcatcttgtgggttgacctctcaagg
ggcgagtttcgggagtggcgctatcccggcgagatggctaggatgtttgttggaggtagg
ggctatgcgatcaagatactctgggaccacttgccggaaggtgctgaccccctgggtccc
gacaatttgctaatactcgctgtcggacctctcaccgggcttcctggcccctctaccggg
aagatggtcgtggctgctaaaagcccgctaacgggcggctacggcgacggcaatataggt
accagggctgctgtcaacctacgagccgccggctgggacgcagtggtcattcggggcgtg
gccaggaagccctctatactcgtgatagaggatgataaggcctggctagagcccgccgac
gacctatggggcctcgatacgttccgggctgctgacaagctcgaggagaggtttggcaag
accgcaggcatactgttgatagggcctggcggcgagaacatggtacgctatgcaaccatc
gtatcgcagaagggccgctccggcggtagaccaggcatgggcgctgttatgggctccaag
aagctgaaggcgatagttgtaaggggcacgaaaaagccagagttattccatccggaggag
gagctaaggataggcacagaggccattaaatttgtcaagagtagcccgaactacgagttc
tggatgaggcagggcacgatgatgacaatcgagtggtcgcagaatgccagcgtactgcca
acctacaacttccgcgagggcgtcttcgacggatgggaggggataagcggtaactacatg
gagaaagtaaaggttaccacgaagagctgcccactatgcccgatgagctgtggccatgtg
gtaaaggatgctgagggccagccctccgagctagactacgagaatgtggcaatgctcggc
agtaacataggaatatccaggctcgaggatgctgcgctgcttaacaggctagcagacatg
tacggcattgatacgattagcctggggaacactctcggctacgcacttgaggcggcggag
agaggtaagctagaactagacgccacttggggcgaaacgaggaagctcgcaaagcttgta
gaggacatagcctatcgccgcggcgtcggcgacctcctcgcagagggtgtgaagcgagtc
tccgagaaggttggcgagacctggtatgctatgcatgtcaagggcctagaagtgagcgct
tatgattgtcacgcagccccgggcatggcactgagctatgctacgagcccgattggggca
caccataaggatgcctgggtcatatcgtgggaggtgcagcacggcaggttcaagtatggc
agggagaaggtgctaagggttatcgagctgcagagaatacgcggtggcttcttcgagaca
gcagtaacctgcagatttcccttcgtagagctgggcctcgcactagactactacgtgaaa
atgttccaggccgcaacagggctcagctacagtctcgaagaccacttcaccgtcgccgac
cggatctacacgctgataaggctgttctgggtgcgcgagcacggtggctggggcatagag
atggacctgccgccggagaggtggttccgcgagcccctgaccaagggcccgcttaagggc
gccaagctagacaaggacaagttcatcgagatgctgaagatatactacagggagaggggc
tgggctgagaacggtgtaccattgccggagacggtgaaaaaactcggtctaggcgaggat
gctgtaaggctagcagaaagatactcatcaaaataa

DBGET integrated database retrieval system