KEGG   Hyperthermus butylicus: Hbut_0503Help
Entry
Hbut_0503         CDS       T00468                                 

Definition
(GenBank) Ribulose bisphosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
hbu  Hyperthermus butylicus
Pathway
hbu00630  Glyoxylate and dicarboxylate metabolism
hbu01100  Metabolic pathways
hbu01120  Microbial metabolism in diverse environments
hbu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hbu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Hbut_0503
Enzymes [BR:hbu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Hbut_0503
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N LigA
Motif
Other DBs
NCBI-ProteinID: ABM80365
UniProt: A2BK54
LinkDB All DBs
Position
complement(484308..485633)
Genome map
AA seq 441 aa AA seqDB search
MHEHFDSIYLEFVDESYKPGKDEVIAVFRVTPAQGISIKDAAGRIAAESSVGTWTTLSVK
PSWFEKLKAKAYRFHDLGDGSWLVWVAYPVELFEEGSIPNFASSILGNIFGMKAIAGLRV
EDVYFPPSYLETFPGPNKGIQGVREILGIKDRPILATVPKPKLGYTPEEYGRVAYEILIG
GIDLVKDDENFASQPFCRFEARLKEVMKAIDRAEKETGERKGYLANVTAPIREMEKRIKL
VADYGNKFIMIDFLTAGWAALQHARELAEEYDLAIHGHRAFHAAFTRNPKHGVSMFLVAK
LARMAGVDHVHVGTPGVGKMDAKTREVLEHTRIVREQYYRPKEGDLFHLEQPWSNIKPVF
PVASGGLHPGTLPEVIRVMGKDIIMQVGGGVLGHPDGPEAGARAVRQAVEAAMKGISLDE
YAREHRELARALEKWGYVRPV
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgcacgagcactttgacagcatctacctcgagtttgtcgacgaaagctataagcccggc
aaggacgaggtcatagccgttttccgtgttacaccagcccagggcatttcaataaaggat
gcagctggccgtatagctgccgaaagcagcgtgggtacctggacaacattgagcgttaag
cctagctggtttgagaagctaaaggctaaggcttaccgattccatgaccttggcgatgga
agctggctggtatgggttgcatatcctgtcgagcttttcgaggaaggcagcataccaaac
tttgctagcagcattctaggcaacatcttcggcatgaaggctattgctggtctccgtgtc
gaggacgtctacttcccaccaagctatcttgagaccttcccaggaccgaataagggcatc
cagggtgtacgcgaaatactcggcatcaaggatagaccgatacttgcaaccgtgccaaaa
ccaaagctcggttacaccccggaggagtacggcagggtagcctatgagatccttatcggc
ggcatagacctagttaaggacgatgaaaactttgcaagccagcccttctgcaggtttgaa
gctaggcttaaagaggtaatgaaggctattgatagggccgagaaagagacaggagagcgc
aaaggctacctagcaaacgttacagcgccaataagggagatggagaagcgtataaagctt
gtggcagactatgggaacaagttcataatgatagactttctcacagctggctgggcagcc
ctccaacacgcgagggagctggcagaggaatacgacctggccatacatggccaccgcgcg
ttccatgcagcgttcacgagaaacccaaagcatggcgtctcaatgttcctagtagccaag
ctagccaggatggctggtgtagatcatgtacatgtggggacacccggcgtgggcaaaatg
gatgcaaagactagggaggttctagagcatacaaggattgttagagagcagtactaccgg
cccaaggagggcgacctcttccacctagaacagccgtggagcaatattaagcccgtcttc
ccagttgctagtggaggcctacacccaggaacactaccggaagtcataagggttatgggc
aaggacataataatgcaggttggcggtggagttctaggccaccccgatggcccagaagct
ggtgctagagctgtgaggcaggcagtagaagcagccatgaagggcatatcgttagacgag
tatgccagggagcaccgtgagctggcacgtgcactagaaaaatggggttatgtcagaccc
gtttag

DBGET integrated database retrieval system