KEGG   Helicobacter pylori PeCan18: HPPC18_04630Help
Entry
HPPC18_04630      CDS       T02036                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
hca  Helicobacter pylori PeCan18
Pathway
hca00473  D-Alanine metabolism
hca01100  Metabolic pathways
hca01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:hca00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    HPPC18_04630
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    HPPC18_04630
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hca01011]
    HPPC18_04630
Enzymes [BR:hca01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     HPPC18_04630
Peptidoglycan biosynthesis and degradation proteins [BR:hca01011]
 Precursor biosynthesis
  Racemase
   HPPC18_04630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AFI02669
UniProt: I0EIA0
LinkDB All DBs
Position
complement(970028..971161)
Genome map
AA seq 377 aa AA seqDB search
MLKRASFVEVNTASLRHNFNAVKSIVPKDACVMAVVKANAYGAGALKASEIFLQEGANYL
GVATLDEALELRSHFSQTPILILGYSPNANASMLIDNDLSVMVFSLEQAEVFSQMALKSQ
KRLKIHLKIDTGMHRLGLEPTFKSIEIVKKIRALKGLEIEGIFTHLSNADANIKTHAKNQ
MKAFNAFLEQLLNQKIEFKYRHAYNSAGILSLCNGNENRFLNLYRPGIMLYGFYPSNEIK
ESSQTILKNVISLKAQIVQIKRVKKGEFIGYGEHFYTNEETLVGTLALGYADGLVRALGN
RIQVAINNQLAPLIGKVCMDQCFVKLNDIQAKEGDEVILFGDKSVKANDASEIAALLNTI
PYETISTLSKRLERVYV
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaagggcgagttttgtagaagtgaataccgcttctttaaggcataattttaat
gcagtcaaaagcattgtccctaaagacgcttgtgtcatggcggttgtcaaggcgaacgct
tatggggcgggggcattaaaagcgagcgaaatttttttacaagaaggggctaattattta
ggggtagcgaccttagatgaagctttagaattgcgctctcatttttctcaaacccccatt
ttgattttaggttatagtcctaacgctaacgcttccatgctgattgataacgatttgagc
gttatggtttttagccttgaacaagcggaagttttttctcaaatggctttaaagtctcaa
aaacgcttaaaaattcatctcaaaattgataccggcatgcaccgcttgggtttagagcct
acttttaaaagcatagaaatcgttaaaaaaatccgcgctttaaaaggcttggaaatagag
gggatattcacgcatttaagcaacgctgatgctaacattaaaacccatgctaaaaaccag
atgaaagcctttaacgcttttttagaacagcttttaaatcaaaaaatagaatttaaatac
cgccatgcttataattccgccggcatcctttctttgtgtaacgggaatgaaaaccgcttc
ttaaacctttatcgcccaggcatcatgctctatggtttttacccttctaatgaaataaaa
gagtcgtctcaaacgatattaaaaaatgttatcagtttgaaagcgcaaatcgttcaaatc
aaacgagtcaaaaaaggcgaatttattggctatggcgagcatttttatacgaatgaagaa
actttagtcggcactctggctttagggtatgcagacgggttggtgcgcgctttaggcaat
cgcattcaagtagcgatcaacaaccaattagcccctcttattggcaaggtgtgcatggat
cagtgctttgtcaagctcaatgatattcaagccaaagagggcgatgaggtcatcttgttt
ggggataaaagcgttaaggctaatgacgcaagcgagattgctgcgcttttaaacaccatt
ccttatgaaaccatcagcactttatccaaacgcttggagcgcgtttatgtgtga

DBGET integrated database retrieval system