KEGG   Helicobacter cinaedi CCUG 18818 = ATCC BAA-847: HCBAA847_2187Help
Entry
HCBAA847_2187     CDS       T02494                                 

Definition
(GenBank) enoyl-(acyl carrier protein) reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
hcb  Helicobacter cinaedi CCUG 18818 = ATCC BAA-847
Pathway
hcb00061  Fatty acid biosynthesis
hcb00780  Biotin metabolism
hcb01100  Metabolic pathways
hcb01130  Biosynthesis of antibiotics
hcb01212  Fatty acid metabolism
Module
hcb_M00083  Fatty acid biosynthesis, elongation
hcb_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:hcb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    HCBAA847_2187
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    HCBAA847_2187
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    HCBAA847_2187
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hcb01004]
    HCBAA847_2187
Enzymes [BR:hcb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     HCBAA847_2187
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     HCBAA847_2187
Lipid biosynthesis proteins [BR:hcb01004]
 Fatty acid synthase
  Component type
   HCBAA847_2187
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: BAM33402
UniProt: I7HE78
LinkDB All DBs
Position
complement(2064659..2065495)
Genome map
AA seq 278 aa AA seqDB search
MILKGKKGLIVGVANNRSIAYGIAKACREQGAELAFTFLNEALEKRVRPIAEELGAKERV
YELDVGKEAHFSSLASSLKKDFGSFDFIVHSVAFAPKDALEGDFIQTSKEAFNTAMEISV
YSLIELVRTLVPLLNNGASILTLTYLGSVKYVTNYNVMGVAKAALESSVRYLAYDLGKQG
VRVNAISAGPIKTLAASGISDFNIMLKWNEANAPLCKNVSIEQVGNSAMYLLSDLASGVT
GEVHYVDAGYNIMGMCATESIDGKVTPRWDILTANTRK
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgatcttaaaaggcaaaaagggacttatcgttggtgtggcaaataatcgctctatcgct
tatggcatagctaaggcgtgtagagagcaaggagcagagcttgcttttacatttttgaat
gaagcattagagaagcgtgtgcgtcctattgctgaggaattaggagcaaaggagcgtgta
tatgagcttgatgtgggcaaggaagcacattttagctctcttgcttcaagtcttaaaaaa
gattttggctcttttgattttatcgtgcattctgtggcgtttgcaccaaaagatgcatta
gagggggattttatccaaacaagcaaggaagcctttaacacagcaatggaaatttctgtg
tattctcttattgagcttgtccgcacacttgttccattactgaataatggagcgtctata
ttgactttgacttacctaggcagtgtgaagtatgtaacaaactataatgttatgggtgtg
gcaaaggcagcgttagaatctagtgtgcgttatcttgcctatgatttaggcaaacaaggt
gtgcgtgtgaatgccatctccgctggtcccatcaaaacacttgcagcaagtgggataagt
gattttaatattatgcttaagtggaatgaggcaaatgcaccattgtgtaaaaatgttagc
attgagcaggtggggaactcggctatgtatcttttgagtgatttggcaagtggcgttacg
ggtgaggtgcattatgttgatgcgggatataacattatgggtatgtgtgctactgaaagc
attgatggtaaggtaacgccacgatgggatatactcacagctaacactcgcaaatag

DBGET integrated database retrieval system