KEGG   Helicobacter cinaedi CCUG 18818 = ATCC BAA-847: HCBAA847_2216Help
Entry
HCBAA847_2216     CDS       T02494                                 

Definition
(GenBank) penicillin-binding protein
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
hcb  Helicobacter cinaedi CCUG 18818 = ATCC BAA-847
Pathway
hcb00550  Peptidoglycan biosynthesis
hcb01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:hcb00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    HCBAA847_2216
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    HCBAA847_2216
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hcb01011]
    HCBAA847_2216
Enzymes [BR:hcb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     HCBAA847_2216
Peptidoglycan biosynthesis and degradation proteins [BR:hcb01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   HCBAA847_2216
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer DUF3139
Motif
Other DBs
NCBI-ProteinID: BAM33431
UniProt: I7GZQ0
LinkDB All DBs
Position
2088186..2089973
Genome map
AA seq 595 aa AA seqDB search
MMSLRYKFLIIFFVVVWLIICMRLFVINVINHEYYEKFAEKNAIRTEVLLPMRGLILDRN
NEPLAINEIGFSISLIPKIRNKQIIESEVDKIVSFLPHLDKDELIDTYNKNNHAYNHAPV
ELVGFVPYAQMLNIYAYLKRSSNIIITANSKRLYPNESAASHVIGYVAKANDNDIQKNPL
SQYSKVIGKDGIEKTYNTYLQGEAGYRKSQINSLYKQVQLLQEDDVLKRNDLRLSLDLKL
QESIDRDFEFHSGAVIVMNVHNGEILAAGSYPEYNINLFVDGISHKNWQELTENIHKPLI
NKLVYGRYPPGSVIKMGMVLAFLEFAGITEHSVIQTPPYIEFGNRKFRDWKASGHGSSDA
IKAIRESVDVYFYTLSQRAGIENMASVLSQMGIGELTGIDIPNEVKGILPSPEWKLRRYG
EQWYGGDTITTSIGQGYFLSTPMQIARYTALIASGKLVTPHFAKDFNNEPARFESKDVLN
EFQKSKLDVLKKGMYQVCSVPGGTAYFRTQGTKVKLACKTGTAQVVGIPQDIQRRVREAD
MEYFHRSHSWITAFLPYENPQYAVTILIEHGGSGGNGGPLLVKIANKLKELGYVK
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgatgagtttgcgttataaattccttatcatcttttttgttgttgtgtggcttattatc
tgtatgcgtttatttgtgataaatgtcatcaatcacgagtattatgaaaaatttgccgag
aaaaatgccatacgcacagaagtgcttttacctatgcgagggcttatccttgataggaat
aatgaacctttagccattaatgagataggtttttctatctcgcttattcctaagattcgc
aataagcaaattatagaatctgaagtggataaaattgtctcttttctcccacatttagat
aaagatgagcttatagatacatataacaaaaacaaccacgcttataatcacgcccctgtg
gagctagtaggctttgtcccttatgcacaaatgctcaatatctatgcgtatttgaaacgc
tcttcaaatatcattattaccgctaatagcaaacgactttatcccaatgagagtgcggct
tcacatgtgattggctatgtggcaaaggcaaatgataatgatatacagaaaaatcccctt
tcgcaatacagtaaagtcataggcaaagatggcattgaaaaaacctataatacatatttg
caaggtgaagcggggtatagaaaatctcaaatcaactccttgtataaacaagtgcaactt
ttacaagaagatgatgtgctaaaacgcaatgatttgcgtctctcgcttgatttaaaattg
caagaaagcattgatagggactttgagtttcactctggagcagtgattgtaatgaatgtg
cataatggcgagattctagctgctggaagctacccggagtataatattaatctttttgtt
gatggtattagccataaaaattggcaggagcttacagaaaatattcataaacctttgatt
aataagcttgtgtatggacgctatccgcccggctcggttatcaaaatgggtatggtttta
gcatttttagagtttgccgggataactgagcatagtgtcattcaaacaccaccctatatt
gaatttggtaatcgtaaattccgcgattggaaggcttctggacacggtagctctgatgca
ataaaggcaattagagaatctgttgatgtgtatttttacacgctttcacaaagagcaggt
attgaaaatatggcaagtgtgctaagccaaatgggtataggcgaactcaccggcattgac
attccaaatgaagttaaaggcattctgccaagtccggagtggaagctccgccgatatggg
gagcaatggtatggtggcgatacgattaccacctccatcgggcagggctattttctctca
acccctatgcagattgcaagatataccgcacttattgcttcaggcaaacttgtaacgcca
cattttgcaaaagattttaataatgaacctgcaaggtttgaatctaaagatgttttgaat
gagtttcaaaaatcaaagcttgatgtgctaaaaaaaggaatgtatcaagtatgttctgtc
ccgggtggaacggcatattttcgcacacaagggacaaaagtaaaacttgcgtgtaagacg
ggcacggctcaagttgttgggattccacaagatattcaaagacgcgtgagagaagcagat
atggagtattttcatcgctctcattcgtggattaccgcatttttaccctatgagaatcca
caatatgcggtaacaattcttatagaacacggcggaagtggggggaatggcggaccattg
cttgtaaaaatcgccaataaacttaaagagcttggctatgttaaataa

DBGET integrated database retrieval system