KEGG   Helicobacter cetorum MIT 00-7128: HCW_01095Help
Entry
HCW_01095         CDS       T02032                                 

Gene name
fabZ
Definition
(GenBank) (3R)-hydroxymyristoyl-ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
hce  Helicobacter cetorum MIT 00-7128
Pathway
hce00061  Fatty acid biosynthesis
hce00780  Biotin metabolism
hce01100  Metabolic pathways
hce01212  Fatty acid metabolism
Module
hce_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:hce00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    HCW_01095 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    HCW_01095 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hce01004]
    HCW_01095 (fabZ)
Enzymes [BR:hce01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     HCW_01095 (fabZ)
Lipid biosynthesis proteins [BR:hce01004]
 Fatty acid synthase
  Component type
   HCW_01095 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT 4HBT_2
Motif
Other DBs
NCBI-ProteinID: AFI03512
UniProt: I0EKP3
LinkDB All DBs
Position
complement(203740..204231)
Genome map
AA seq 163 aa AA seqDB search
MESQQSQQTLASSFSIEDILQILPHRYPMLLVDRVIDLQPHKNIIAYKNITFNEDVFNGH
FPRKPIFPGVLIVEGMAQTGGFLAFTSLWGFDPEVARRKIVYFMTIDKVKFRVPVVPGDR
LEYHLEVLKHKGMIWQVGGTARVDGKIVAEAELKAMIAEREEV
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atggaatcacaacaatcacaacaaactttggcctctagtttttctattgaggatatttta
caaattttgccgcatcgctatcctatgcttttagtagatagagtaatagatttacaacca
cataaaaatatcatcgcatacaagaatatcacttttaatgaagatgtgtttaatgggcat
tttccacgaaagcctattttcccgggtgttttaattgtagagggtatggcacaaaccgga
ggctttttagcctttacgagtttgtggggatttgaccctgaggtagcaagaagaaaaatt
gtctattttatgactattgataaggttaagtttcgtgtgcctgtagttcccggagataga
ttagaatatcatttggaagttttaaagcacaagggtatgatatggcaggttggtggcact
gctagagtagatggtaaaatagtagctgaggctgaactaaaggctatgattgcagagaga
gaagaagtatga

DBGET integrated database retrieval system