KEGG   Hahella chejuensis: HCH_01524Help
Entry
HCH_01524         CDS       T00307                                 

Gene name
rbn
Definition
(GenBank) ribonuclease BN-like family protein
  KO
K07058  membrane protein
Organism
hch  Hahella chejuensis
Brite
KEGG Orthology (KO) [BR:hch00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    HCH_01524 (rbn)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB HTH_36 MarR_2 MarR
Motif
Other DBs
NCBI-ProteinID: ABC28382
UniProt: Q2SLU2
LinkDB All DBs
Position
1522819..1524186
Genome map
AA seq 455 aa AA seqDB search
MSKATIETWVSRLDRWLWENETGGAAGGVMRVLWHSARVLFAVVRDVLFGHVTLHAMGLV
YTTLLSIVPLLALSFSVLKGFGVHNQLEPLLENVFQAFGEKGPELVQNVLAFVDNVKVGV
LGSVGLGLLIYTVISLVQKVERSFNEIWRVSQIRSLAQRFSSYLSVIVVGPLLAFSAMGA
TATLVGTDMAQTVLSIEPFGRLFSLATRMAPYVIIVALFTFMYRFIPNTKVRTRYAFIGG
LGAGIAWQTTGYVFAKFVVGTSNYEAIYSGFAVGILVLIWLYISWLILLMGASVAFYGQH
SHQITRQRRVRPCAVIDERTGLALVYKVAKKFDQQGGGESISDLEDTLSVGPETIQRIID
KLLKKGVLAIMGDEADSLIPARPLDRITLAELMHVLRSPEHSLPASLYSDKSVDAIAKGV
TAAMEASLGQMTLAAWVRGEETVVREATSPERAAS
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaagcgacgattgaaacctgggtgtcgcgattggatcgctggctttgggagaac
gaaaccggcggcgccgcaggcggcgtgatgcgggtattgtggcatagtgcgcgcgttttg
tttgcggtggtgcgcgacgtattattcggccatgtgacgctgcacgcgatgggattggtg
tacacgacgctgctctccatcgtgccgttgttggcgttaagtttctccgtattgaaagga
tttggcgttcataatcagctggagccgctgctggagaatgttttccaggcgttcggggaa
aaagggccggaactggtgcaaaacgtgctcgcatttgtcgacaatgtcaaagtcggcgtg
ttgggctcggtgggcctgggattgttgatctatacggtcatctctctggtgcagaaggtg
gagcgctcctttaacgaaatctggcgggtgtcgcagattcgctccctggcgcaacgattc
agctcttaccttagcgtcattgttgtcggtccgttgctggcgttttccgccatgggcgcc
acggcgactctggtggggacggacatggcgcaaaccgtcttgagtattgaaccttttgga
cggctgttttctctcgccactcgtatggcgccctatgtcatcatcgtggcgctgttcacc
ttcatgtatcgctttatccccaacaccaaggtgcgcacccggtatgcgttcataggcgga
ctcggggcggggatcgcctggcagactacaggttatgtgttcgccaagtttgtggtcggt
acatccaactacgaagcgatttactcgggctttgctgtgggcatcctggtcctgatctgg
ttgtatatctcctggctgatcctgttgatgggggcgtcagtggcgttctacggccagcat
tcccaccagatcacccgacagcggcgggtgcgcccctgtgcggtgattgacgagcgcaca
gggctggccctggtgtacaaggtggcgaaaaagtttgatcagcagggaggaggcgagagc
atctctgatctggaggatactctatcggtggggcctgagacgattcagcgcattatcgac
aaactgttgaagaagggcgtgttggctattatgggggacgaagcggattcgctgattccc
gcccgccctttagaccgcattaccctggcggaattgatgcatgtgctgcgttcgccggag
cacagtctgcctgcctccttgtactcagataagtctgtggacgctatcgccaagggagtg
acggcggcgatggaggcgtcgctagggcaaatgaccctggctgcctgggtgcggggcgag
gagacggtggtcagagaggcgacgtcgccggagagagcggcgagttga

DBGET integrated database retrieval system