KEGG   Hahella chejuensis: HCH_02800Help
Entry
HCH_02800         CDS       T00307                                 

Definition
(GenBank) putative GTPase (G3E family)
Organism
hch  Hahella chejuensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: cobW CobW_C RsgA_GTPase ATPase_2 T2SSE MobB TsaE ABC_tran MeaB Viral_helicase1 AAA_33 AAA_22 AAA_14 MMR_HSR1
Motif
Other DBs
NCBI-ProteinID: ABC29578
UniProt: Q2SIE6
LinkDB All DBs
Position
complement(2894323..2895540)
Genome map
AA seq 405 aa AA seqDB search
MRKLPVTVLSGFLGAGKTTLLNHILQNRDGLKVAVIVNDMSEINIDASQVNREVNLNRAE
EKLVEMSNGCICCTLREDLLQEVSRLARENRFDYLVIESTGVSEPLPVAETFTFRDEHGV
SLADIARLDTLVTVVDGVNFMRDYENAETLQEVGESLGAEDERNVAELLVDQIEFSDVLV
VSKLDLISQAEREELFSVLRKLNPEADIVPALMGQTPLSKVLNTGRFDFERAARAPGWLQ
ELRGEHTPETEEYGIGSISYRARRPFHPQRFHQFLEREWNNGRLLRSKGYFWLASRPYEA
GGWSQAGGVMRYSYAGLFWAGAPQEYWPQDEESLRLIRNNWLEPYGDRRQELVFIGQGID
WDRLRSELDACLLTDEELAQGEKVWVNYPDPLPIWRSFQDERESA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaattgcctgtgaccgtgctgtcgggatttctcggcgcaggaaaaaccaccctg
ctcaaccatattctgcaaaaccgggacggcctcaaagtcgcggtcatcgttaacgacatg
agtgaaatcaacattgacgccagccaggtcaatcgcgaagtgaatctgaatcgcgcggag
gagaaactggtggaaatgagcaatggctgtatctgctgcactctgcgtgaagatttgttg
caggaggtttcccgcctggccagggaaaaccgtttcgattacctggtcatcgaatccaca
ggcgtatctgaacctctgccggtggccgagacatttacgtttcgggatgagcatggcgtg
agcctggcggacatcgcccgtctggacactctggttacggtagtggatggcgtcaatttc
atgcgtgactatgaaaacgccgagacattgcaggaagtcggcgagtccctgggcgccgag
gacgaacgcaatgtcgccgaactgctggtggaccagatcgagttcagcgacgtgctggta
gtaagcaagcttgacctgatcagtcaggcggagcgggaagagctgttttccgtactgcgc
aagctcaatcccgaagcggatatcgttcccgccttgatgggacagacgccgctgtctaaa
gttttaaacactggcagattcgatttcgaaagagccgcccgcgcgccgggctggctgcag
gaactgcgcggcgagcatacgccggaaaccgaagagtacggtatcggcagcatcagttat
cgggcgcgccgtcctttccatccccagcgcttccatcagtttttggagcgggagtggaat
aatggccgcctgttgcgttccaaaggatacttctggctcgccagtcgcccttatgaagca
ggcggctggtctcaagccggcggcgtgatgcgctacagctatgcaggtctgttttgggcg
ggcgcgccgcaagagtactggccacaggatgaagagtctctgcgcctgattcgcaacaac
tggctggagccttatggcgatcgccgccaggaactggtgtttatcggtcagggaatcgac
tgggaccgactgcgcagcgaactcgatgcttgtctgctgacggatgaggaactggcgcaa
ggggaaaaagtctgggtgaactaccctgacccgctcccgatctggcgttcgtttcaagat
gaaagggaatcggcgtag

DBGET integrated database retrieval system