KEGG   Hahella chejuensis: HCH_06125Help
Entry
HCH_06125         CDS       T00307                                 

Gene name
trpE
Definition
(GenBank) anthranilate synthase component I
  KO
K01657  anthranilate synthase component I [EC:4.1.3.27]
Organism
hch  Hahella chejuensis
Pathway
hch00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hch01100  Metabolic pathways
hch01110  Biosynthesis of secondary metabolites
hch01130  Biosynthesis of antibiotics
hch01230  Biosynthesis of amino acids
hch02024  Quorum sensing
Module
hch_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hch00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HCH_06125 (trpE)
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    HCH_06125 (trpE)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    HCH_06125 (trpE)
Enzymes [BR:hch01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     HCH_06125 (trpE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_bind Anth_synt_I_N
Motif
Other DBs
NCBI-ProteinID: ABC32773
UniProt: Q2S9A1
LinkDB All DBs
Position
6271993..6273468
Genome map
AA seq 491 aa AA seqDB search
MTPEQLAAYHQAGYNRVPVVREVMADLDTPLSTYLKLANAPYTYLLESVQGGDKWGRYSI
IGLPCRSVLKVNGHQINLYDNNALTESTECADPLAYIETFQQRFKVPDVEGLPRFNGGLV
GYFGYDTIRYIEPKLAKSTPPDPLGTPDILLMVSDELVVFDNLSGRLMLIHHVDPGAAEA
SERAQARLDELETLLRRPIPEHNLHVQQDLQIAEEDFASGFTQPNFEAAVEKIKEYVLAG
DVMQTVISQRMSVPFTAEPINLYRSLRCLNPSPYMYHLDLGDFHVVGSSPEILAHLEDGV
ATVRPIAGTRKRGATEAEDKALEEELLADPKELAEHLMLIDLGRNDVGRVSDIGSVELTD
KMVIERYSHVMHIVSNVTGKLRQGLSAIDVLRATLPAGTLSGAPKIRAMEIIDELEPVKR
GVYGGAIGYLSWNGNMDTAIAIRTAVIKDKTLYIQAGAGVVADSAPRLEWKETLNKGRAV
FRAVAMAQKGL
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgacacccgaacaattggccgcctatcatcaggcgggatataaccgcgtcccggtcgtc
cgcgaagtaatggcggacctggacaccccgctgtccacctatctgaaactggccaacgcg
ccctatacctacttactggagtccgttcagggcggcgacaaatgggggcgctactccatt
atcggcctgccctgccgcagcgtgctcaaggtcaacggccatcagatcaacctctatgat
aacaacgcgctgacggaatccaccgaatgcgcagacccgctggcctacatcgaaaccttt
cagcaacgtttcaaggtgccggacgtagagggcctgccccgtttcaacggcggcctggtg
ggctacttcggctatgacaccatccgctatatcgagccgaagctggccaagagcacgcct
cccgatccgttgggaacgccggatattctgttgatggtctcggatgagctggttgtgttc
gataacctgagcggccgtctgatgttaatacatcatgtcgatcccggcgcagcggaagcc
agcgaacgcgcccaggcgcgtctggatgagttggaaaccctgctgcgacgaccgatcccc
gagcataatctgcatgtccagcaagacctgcagattgccgaggaggatttcgcttcaggt
ttcacgcagccgaacttcgaagccgccgtggagaagatcaaggaatacgtactggctggg
gatgttatgcaaacggtgatctcccaacgtatgtccgtccccttcaccgccgagcccatc
aacctgtatcgttctctccgctgtctcaacccctctccttatatgtaccacctggatctc
ggcgatttccatgtggtcggctcctcaccagaaattctggcgcacctggaagatggcgtc
gccaccgtgcggcccatcgccggcacccgtaaacggggcgccaccgaggcggaagacaaa
gcgctggaagaagagctgctggcggaccccaaagaactcgccgagcacctgatgctgatc
gacctgggccgcaacgatgtcggccgcgtcagcgatatcggcagcgtcgaactgaccgac
aagatggtgatcgaacgctactctcatgtgatgcatatcgtctccaacgtcaccggcaaa
ctacgccagggcttgagcgccattgacgtgctgcgcgccactctgcccgccggcacgttg
agcggagccccgaaaatccgcgccatggagatcatcgacgaactggagccggtaaaacgc
ggcgtttacggcggcgccatcggatatctgtcctggaacggcaacatggataccgccatc
gccattcgcaccgcggttatcaaggacaagacgctttatattcaggccggggccggcgta
gtcgccgattccgcgccgcgcctggaatggaaggaaaccctcaacaaaggccgcgccgtg
ttccgcgccgtggctatggcgcaaaaagggctatga

DBGET integrated database retrieval system