KEGG   Hahella chejuensis: HCH_06188Help
Entry
HCH_06188         CDS       T00307                                 

Definition
(GenBank) D-alanine-D-alanine ligase and related ATP-grasp enzyme
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
hch  Hahella chejuensis
Pathway
hch00473  D-Alanine metabolism
hch00550  Peptidoglycan biosynthesis
hch01100  Metabolic pathways
hch01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:hch00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    HCH_06188
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    HCH_06188
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    HCH_06188
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hch01011]
    HCH_06188
Enzymes [BR:hch01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     HCH_06188
Peptidoglycan biosynthesis and degradation proteins [BR:hch01011]
 Precursor biosynthesis
  Amino acid ligase
   HCH_06188
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_4 CPSase_L_D2 GARS_A ATP-grasp_3 ATP-grasp_5 ATPgrasp_ST ATPgrasp_Ter ATPgrasp_YheCD
Motif
Other DBs
NCBI-ProteinID: ABC32832
UniProt: Q2S942
LinkDB All DBs
Position
complement(6325674..6326669)
Genome map
AA seq 331 aa AA seqDB search
MKIAVLFGGTSEERDVSIASAAQIIPALRSLGHEVFSVDTATGQLSGTDEMRLLQAGVAP
EPPSTSVIADVRGRAIALSAEAFNIRDVDVVFLALHGGAGEDGRIQAMLDLAGLAYTGSN
HIASAVAMDKDLSKQLFRAAGVPTPDWLMAPASSDEVAQKLGWPVVVKPSKQGSTVGLSV
VREASELAKAIELAMNYDDEVMIEKFIPGREFTVGILDGRALLVGEIIVPNEIFDYHAKY
QVGAASEIFPANISETDAAAMQEIALRAHAALKLGVYSRIDFRVEDNGAVWCLEGNSLPG
MTANSLLPQAARAAGIEFPELLERICRGAVT
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcgcagttttattcggcggcacgagtgaagagcgggatgtctctatcgccagc
gccgcgcaaattattccggcgctgcgtagtctggggcatgaggtgttttccgtggatacg
gccactggacaactgtctgggacggatgaaatgcgtcttctgcaagcgggtgtggcgccg
gagccgccgtcgacgtcggttatcgccgatgtgcgaggtcgcgctatcgccttgtctgcg
gaggcttttaatatccgtgacgttgatgttgtttttctggcgttgcatggcggcgcagga
gaagacggacggattcaggcaatgttggatctggctggtctggcgtataccggcagtaat
catattgcgagtgcggtggccatggacaaagacctgagtaagcaactgttccgcgccgcc
ggcgtacccacgccggattggttgatggcgccagcgagcagtgatgaagtggcgcaaaag
ttaggttggccagtggtcgtcaaacccagcaagcaaggttccacggttggtttaagcgtg
gtgcgggaagcgtcggagttggcgaaggcgattgagcttgcgatgaattacgacgatgaa
gtcatgattgagaagttcatccctggacgagaattcactgtcggaatattagatgggcgg
gcgttgctagtaggcgaaatcatcgttcctaacgagatatttgattaccacgccaagtat
caggtgggcgccgccagcgaaatatttccggcgaatatttctgagactgacgccgccgct
atgcaggagatcgcattgcgtgcgcatgccgcgctgaagttgggcgtgtacagccgaatc
gatttccgtgtggaggataacggcgcagtatggtgtctggaaggtaattcgttgccgggg
atgactgcgaacagtctattgccgcaagcggcgagggccgccggtattgaatttcccgaa
cttctggagcggatctgccgtggcgctgtaacttga

DBGET integrated database retrieval system