KEGG   Hahella chejuensis: HCH_06725Help
Entry
HCH_06725         CDS       T00307                                 

Definition
(GenBank) Glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
hch  Hahella chejuensis
Pathway
hch00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:hch00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    HCH_06725
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hch02000]
    HCH_06725
Enzymes [BR:hch01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     HCH_06725
Transporters [BR:hch02000]
 Other Transporters
  Pores ion channels [TC:1]
   HCH_06725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C
Motif
Other DBs
NCBI-ProteinID: ABC33351
UniProt: Q2S7M3
LinkDB All DBs
Position
complement(6842729..6843382)
Genome map
AA seq 217 aa AA seqDB search
MASDSKIVLFHCPQSRSTGSMVLLEELEAAYEVKLINIRNGENRRDEYLQVNPLGKVPAL
QHGDALITEQVAIFLYLADLFPQAGLAPALNDPLRGPYLRWMVYYASCFEPAVVDKAMQR
EPAPRDTSPYADYDLMLSGIVERIASGPYILGEKFSAADVLWGMAFHWCTQFGLVARTEV
IDAYIKRVTSRRSFSEVLARDVEMAADLQAKTETSAD
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggcttctgattcgaaaattgtgttgtttcactgcccccaatcccgctccactggctcc
atggttttgttggaggaactggaagcagcttatgaagtgaaactgatcaacatccgtaat
ggcgaaaaccgccgggatgagtatttgcaggtgaatcccttgggcaaagtccctgcactg
cagcatggcgatgcgttgatcacggagcaggtggcgatctttctttatcttgctgacttg
tttccacaagcgggcctggctccagcgttgaatgatcctttgcgcggaccttatctgcgt
tggatggtgtattacgccagttgttttgagccggcggtggtggacaaggccatgcaaaga
gagcccgcgccgcgggataccagcccttatgcggattatgacctcatgctaagcggcatc
gtggagcgcatcgccagcggcccctacattctgggcgaaaagttctccgcggcggacgta
ttgtggggaatggcttttcattggtgtactcagtttggtttggttgcgcgcacggaggtg
atcgacgcctatatcaaacgcgtcaccagtcgccgcagtttcagcgaagtgctggccaga
gacgttgagatggccgccgacctacaggcgaaaacggaaacttcggcagactga

DBGET integrated database retrieval system