KEGG   Hahella chejuensis: HCH_06922Help
Entry
HCH_06922         CDS       T00307                                 

Definition
(GenBank) FOG: PKD repeat
Organism
hch  Hahella chejuensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PKD PPC Trypsin_2 SoxZ ChitinaseA_N DUF5011
Motif
Other DBs
NCBI-ProteinID: ABC33539
UniProt: Q2S735
LinkDB All DBs
Position
7036117..7037904
Genome map
AA seq 595 aa AA seqDB search
MKTKIAWVAGLALSLTLSANLQAASDDAVAVPQPPITIASETQFKGLLTDERQLRSESTS
AYQAISDRRITIHRENASFIKVHFSRFEIPEGGYVVVRNAQGDIAHRYGGANPSLHTLRE
GDDGTTSFAALSVIGSTAIVEYFPGASGQASYKIEVDSVMEGFPQEEIDELMSQQASGFS
TCGVNERRDVQCWADSHPEEYERSRPVARILVNGSSLCTAWRVGPDNRVFTNNHCVSSQS
GVANTEVWFNYQRTSCGSGSLAGTKVVTGAAMLATNYELDYTLFTVNNFSSIQSFGYFGL
DVRPATNQERIYIPQHGSGNPKELSIESDQNSGGLCRVDRPSANGRGTGTDMGYNCDTIG
GSSGSPVLAAQTNRVIALHHFGGCPNQGVLIHKIWPQVAGYFNNQIPPGDNETPNGDPVA
DFAFAVDRLEVRFSDESSDSDGEIVSWQWDFGDGNSSISRNPTHTYASTGGYSVSLKVTD
NDGNSASKTQTVSVGDAPRIEENNLSDNTGDWKHYKMTVSSGMSKLTATISGGSGDADLY
VRQGAQPTTSQYNCRPYTNGNNEVCTLNNPAAGDWYISIRAYRDYSGVDLVGELE
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaaaaatagcttgggtcgccgggcttgctttgtccttaacactatccgccaac
ttgcaggccgcgtcagacgacgccgtcgcagtcccccaaccacccatcaccatcgcttcg
gaaactcaattcaaagggttactgacggatgaacgccaactaaggagtgaaagcacaagc
gcctatcaggcgatcagcgatcgtcgcataacaatccatagagagaatgccagtttcatc
aaagtacacttttccaggttcgaaatacctgaaggcggctacgtcgtggtccgtaacgct
cagggagatatcgcgcatcgctacggcggcgccaacccatcactgcataccttgcgcgag
ggcgatgatggaacaacgtctttcgccgcgctttccgtcattgggtcaaccgctatcgtg
gagtattttcccggcgccagcggccaagcgtcgtacaagattgaagtcgattccgtcatg
gagggctttccccaggaagagatcgacgagctgatgagtcagcaggcgagcggcttctcc
acctgcggcgtcaatgaaagacgcgacgtgcagtgctgggcggacagccacccggaagaa
tatgaacgctcccgcccagtggcgcgcatactcgtcaatggctccagcctctgcaccgcc
tggcgcgtcggccctgacaaccgggttttcaccaacaaccattgcgtctcgtcccagtcc
ggcgtagccaatacggaagtctggttcaactatcagcgcaccagctgcggcagcggttca
ctggcgggaacgaaagtagtcaccggcgccgccatgctggccaccaattatgagctggac
tacaccctgttcaccgtcaacaacttctcctccatacagtcattcggctactttggcctg
gatgtgcgccccgccaccaatcaggagcgcatctacatcccccagcacggcagcggcaat
cctaaggagctttccattgaaagcgaccagaacagcggcggcttatgtcgggtggacaga
ccttccgccaatggacgaggaaccggcaccgatatgggctataactgcgacactatcggc
ggcagctccggatcgcccgttctcgccgcgcaaacgaatcgcgtcatcgcactgcatcac
ttcggcggctgccccaaccaaggcgtgctgattcataaaatctggccgcaggtcgccggc
tatttcaataaccagattccccctggcgataacgaaactcccaatggcgatcctgtcgcg
gacttcgccttcgcagtcgacagactggaggttcgcttcagcgacgaaagctccgacagc
gacggcgaaatcgtcagctggcaatgggatttcggcgacggcaactcgtccatctcacgc
aacccgacccacacttacgccagcacaggcgggtatagcgtcagcctcaaggtcaccgat
aacgacggcaacagcgccagtaaaacgcaaaccgtcagcgtaggcgacgcgccgcgtatc
gaagagaacaacctctccgacaacaccggcgactggaagcactacaagatgaccgtttcc
tccggaatgagcaaactcaccgccaccatctccggcggttccggcgacgctgacctgtac
gtgcgccaaggcgcccaacctaccacctcccaatacaactgccgaccctacaccaacggc
aacaacgaagtctgcaccctcaacaaccccgccgccggcgactggtacatcagcatccgc
gcctaccgcgattactcaggggtggatctggtgggcgaactggagtga

DBGET integrated database retrieval system