KEGG   Helicobacter cetorum MIT 99-5656: HCD_01265Help
Entry
HCD_01265         CDS       T02033                                 

Definition
(GenBank) penicillin-binding protein 1A
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
hcm  Helicobacter cetorum MIT 99-5656
Pathway
hcm00550  Peptidoglycan biosynthesis
hcm01100  Metabolic pathways
hcm01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:hcm00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    HCD_01265
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    HCD_01265
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hcm01003]
    HCD_01265
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hcm01011]
    HCD_01265
Enzymes [BR:hcm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     HCD_01265
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     HCD_01265
Glycosyltransferases [BR:hcm01003]
 Polysaccharide
  Bacterial polysaccharide
   HCD_01265
Peptidoglycan biosynthesis and degradation proteins [BR:hcm01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   HCD_01265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase
Motif
Other DBs
NCBI-ProteinID: AFI05285
UniProt: I0EQR6
LinkDB All DBs
Position
258734..260722
Genome map
AA seq 662 aa AA seqDB search
MTKKIFYGFGIFVLIVVGVCAVLIVQVWVNTDKDVAKIKDYRPSIASQILDRKGRLIANI
YDKEFRFYAHFEEIPPKIIESLLAVEDTLFFEHGGINLDAIMRAIIKNAKNGRYTEGGST
LTQQLVKNMVLTREKTLIRKLKEAIISLRIEKVLSKEEILERYLNQTFFGHGYYGVKTAS
LGYFKKPLDKLSLKEIAMLVALPRAPSFYDPTKNLEFSLSRANDILRRLYSLGWISSSEL
KPALNEVPIVYNQTSTQNIAPYVVDEVLKQLDHLDGLKTKGYTIKLTLDLDYQRLALESL
RFGRQKILEKIAKEQVVIDKDTPPNENEDNLNASMVVTDTKTGKILALVGGVDYKKSAFN
RATQTKRQFGSAIKPFVYQIAFDNGYSTTSKIPDTARNFENSNYNKNHEQNHAWHPSNYS
RKFLGLVTLQDALSHSLNLAIINLSDQLGFEKVYHSLNDMGFKNLPKDLSIVLGSFAISP
IEAAEKYSLFSNYGSMLKPMLIESITNQQNEVKTFTPIETRQITSKEQAFLTLSVLMNAV
ENGTGRPARISGLEIAGKTGTSNNNVDAWFIGFTPTLQSVIWFGRDDNTPIGKKATGGVV
SAPVYSHFMRNILAIEPSLKRKFDVPKNMHKEIVDKIPYYSSPNSVMPAPKKGNDTEENL
LF
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaaagattttttatggttttggcatttttgttttgattgttgtaggagtttgt
gcggtgcttattgttcaagtttgggttaataccgacaaagatgttgcaaaaatcaaggat
tatcgccccagcattgcttcacagattttagatagaaaggggcgtttgattgctaatatc
tatgataaagaatttcgtttttatgcccattttgaagaaattccccccaaaatcattgaa
agcttgctagctgtagaagacacactcttttttgagcatggaggaatcaacctagatgcc
attatgcgtgccatcattaaaaacgctaaaaatgggcgttacaccgaagggggtagcaca
ctcacacaacagcttgttaagaacatggtgcttacacgagaaaaaacccttataagaaag
ctcaaagaagccatcatttctttacgcattgaaaaagtcttaagcaaagaagaaatctta
gagcgttatttaaaccaaactttttttgggcatgggtattatggtgtcaaaactgcaagc
ctagggtattttaaaaaaccccttgataaactcagccttaaagaaattgccatgctagtt
gctctacctagagctccaagtttttatgaccctacaaagaatttagaattttcgctttct
agggctaatgacattctaaggcgattatattctttagggtggatttcttctagtgagcta
aaacccgctctgaatgaagtgcctattgtttataaccagacttctactcaaaacatcgct
ccttatgtcgtagatgaagtccttaaacaactagaccacttagatggcttaaaaactaaa
ggctacaccattaaattgactttggatttagactatcaacgcttggccttggagtctttg
cgttttgggcgtcaaaaaatcttagaaaaaattgctaaagagcaagtcgtaattgataaa
gatacaccacctaatgaaaacgaggataatttgaatgctagcatggtagttacagacact
aaaacaggtaaaatccttgctctagtgggcggagttgattataaaaaaagtgcttttaat
cgtgccacacaaactaaacgacaatttggaagtgctatcaaaccttttgtgtatcaaatt
gcctttgacaatggctattccaccacttctaaaatccctgatactgcacggaattttgaa
aatagcaactacaataaaaatcatgaacaaaaccatgcttggcatcctagcaactattct
cgcaaatttttagggcttgtaaccttacaagatgccttaagccattctttaaatctagct
atcattaacttaagcgaccagcttggctttgaaaaagtttatcattctttaaacgatatg
ggttttaaaaatctccctaaggacttgtctattgtgctaggaagttttgctatttcacct
attgaggcggctgaaaagtattctctattctccaactatggctcaatgcttaagcccatg
ctcattgaaagtatcaccaaccagcaaaatgaagttaagactttcacccctattgaaacc
agacagattacttctaaagaacaagcttttttaaccctttcggtgctaatgaatgccgta
gaaaatggcacaggccgtccagcacgcatcagtggtttagaaattgcaggcaaaacagga
acttccaataataatgttgatgcttggtttatcggctttacccccactttacaaagtgtg
atttggtttggacgagatgataacacacctattggcaaaaaagcgactggaggcgttgtg
agtgcacctgtatattctcactttatgcgcaatattctagccattgaaccttctttgaaa
agaaagtttgatgtcccaaaaaacatgcataaagaaatcgtagataaaatcccctactac
tctagcccaaattctgttatgccagctcccaaaaaggggaatgacaccgaagagaactta
ttgttttaa

DBGET integrated database retrieval system