KEGG   Helicobacter cetorum MIT 99-5656: HCD_01990Help
Entry
HCD_01990         CDS       T02033                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
hcm  Helicobacter cetorum MIT 99-5656
Pathway
hcm00473  D-Alanine metabolism
hcm01100  Metabolic pathways
hcm01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:hcm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    HCD_01990
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    HCD_01990
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hcm01011]
    HCD_01990
Enzymes [BR:hcm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     HCD_01990
Peptidoglycan biosynthesis and degradation proteins [BR:hcm01011]
 Precursor biosynthesis
  Racemase
   HCD_01990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AFI05422
UniProt: I0ER53
LinkDB All DBs
Position
411868..413010
Genome map
AA seq 380 aa AA seqDB search
MLHRASFVEVNTASLRHNFNLVKTTIPKDAHIMAVVKANAYGAGAIRASQIFLEEGANYL
GVATLDEALELRSHFSKTPILILGYSPNSNASILVENDLSATIFDYSQAEFFSQTALKAK
KRLKVHLKIDTGMHRLGLEPTFKSIETIEKIRALEGLEVEGIFTHLSNADSKIKTHAKNQ
MHAFNAFLEQLLDKQIEFKYRHAYNSAGILSLCNGMENRLLNLYRPGIMLYGFYPSNEVQ
IASQTQEIFLQNVISLKARIVQIKSVKKGEFIGYGEHFYTNEETLIGTLALGYADGLART
LGNRIQVAINHQLAPLIGKVCMDQCFIELTNLQAKEGDEVILFGDKSTKANDAHDIAMLL
DTISYEIISTLSKRLERVYI
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgctacatagagcgagttttgtagaagttaatacagctagtttaaggcataatttcaac
cttgttaaaacaaccattcctaaagacgctcacattatggcggtggttaaagcaaacgcc
tatggagctggagccataagagcgagtcaaatctttttagaagagggggcaaattattta
ggcgtggctactctagatgaagccttagagttacgctcgcatttttctaaaacccctatt
ttgattctaggctatagccctaattctaacgcttctatcctagttgaaaacgatttgagt
gcaaccatttttgactactctcaagcagagttcttttctcaaacggcccttaaagccaag
aaacgcctaaaagtgcatctcaaaattgataccggaatgcatcgcttaggtctagaaccc
acttttaaaagcatagaaaccatagaaaaaatacgcgctttagaaggcttagaagtagaa
ggcatcttcacccatttaagcaacgctgattccaagattaaaacccatgccaaaaaccaa
atgcacgcctttaacgcttttttagagcaacttttagacaaacaaatagagtttaaatac
cgccatgcctacaattcagcgggcattctttctttgtgtaatggtatggaaaatcgtttg
ttaaacctctatcgcccaggaattatgctctatggcttctacccatctaatgaagtgcaa
atcgcctctcaaactcaagagatttttttgcaaaatgttatcagcctaaaagctagaatc
gtgcaaattaaaagcgttaaaaaaggcgagtttataggctatggcgagcatttttatact
aatgaagagaccttaataggcactttagccctaggctatgcggatggattagcacgcact
ttagggaatcgcattcaagtagctatcaaccatcaattagccccccttatcggtaaagtg
tgtatggaccaatgctttattgaattaactaaccttcaggctaaagaaggcgatgaagtc
attctatttggggataaaagcactaaggctaatgatgcacacgacatagccatgctttta
gacaccatttcttatgaaatcattagcactttatccaaacgcttagagcgtgtgtatatt
taa

DBGET integrated database retrieval system