KEGG   Helicobacter cetorum MIT 99-5656: HCD_06810Help
Entry
HCD_06810         CDS       T02033                                 

Gene name
ddl
Definition
(GenBank) D-alanyl-alanine synthetase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
hcm  Helicobacter cetorum MIT 99-5656
Pathway
hcm00473  D-Alanine metabolism
hcm00550  Peptidoglycan biosynthesis
hcm01100  Metabolic pathways
hcm01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:hcm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    HCD_06810 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    HCD_06810 (ddl)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    HCD_06810 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hcm01011]
    HCD_06810 (ddl)
Enzymes [BR:hcm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     HCD_06810 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:hcm01011]
 Precursor biosynthesis
  Amino acid ligase
   HCD_06810 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 GARS_A RimK ATP-grasp_3 ATPgrasp_TupA
Motif
Other DBs
NCBI-ProteinID: AFI06361
UniProt: I0ETU2
LinkDB All DBs
Position
1449200..1450261
Genome map
AA seq 353 aa AA seqDB search
MEFCILFGGASFEHEISIVSAIALKEVLGNKIKHFIFLDENHHFYLIEEANMHSKYFVRI
KEKKLSPLTLTQKGLLKNTLLGSKVIELPLVINLVHGNDGEDGKLASLLEFYRIAFIGPR
IEASVLSYNKHLTKLYAKSLGIKTLDYVLLNENHHANALDFIKPKISFPLIVKPSNAGSS
LGVSVVREESELAYALDGAFEYSKEVLVEPFINGVKEYNLAGCKVKEKNQEHFCLSYVEE
PSKQDFLDFEQKYLDFSRTKAPKATISNALGERLKESFKKLYNDLFNGSIIRCDFFVIDD
EVYINEINPIPGSLANYLFDDFKKVLECLAQSLPKTPKIHTNNSYLLQIQKNK
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
ttggaattttgtattttatttggtggggcaagttttgagcatgaaatcagcatagtgagt
gcgattgcacttaaagaagtgttaggcaataagattaaacattttatttttttagatgaa
aatcatcatttctatcttattgaagaagctaacatgcattccaaatatttcgtccgcatt
aaagaaaaaaagctatctcctttaactcttactcaaaaaggcttactcaaaaataccctt
ttagggagtaaagttatagaactacccttagttatcaatcttgtgcatggaaatgatggc
gaagatggaaaactagcgagcttattagagttttatcgcatcgcttttataggccctaga
attgaagcaagcgtgttgagttataacaagcatttaaccaagctttatgcaaaaagtttg
ggtataaagaccttagattatgtgcttttgaatgaaaaccaccacgctaatgccctagat
tttatcaaacccaaaatcagttttcctttgattgttaaacctagcaacgctgggagttca
ttaggagtgagtgttgttagagaagaaagcgaattagcttacgctctagatggtgcgttt
gaatattctaaagaagttctagtagaacctttcatcaatggggttaaagaatataatttg
gcgggctgtaaagttaaagaaaaaaatcaagaacatttttgtttgtcctatgttgaagag
cctagcaaacaggattttttggattttgagcaaaaatatttggatttttcacgcaccaaa
gcccctaaggctacaatctctaatgctttaggagagcgcttaaaagagagttttaaaaag
ctctacaacgatttgtttaatggctcaatcattcgttgtgatttttttgtcatagatgat
gaagtgtatatcaacgagattaaccccattccaggtagtttggcaaattatttgtttgat
gattttaaaaaggtgctagaatgcttagctcagtcattacccaaaacccctaaaatccat
accaacaactcttatttattgcaaatccaaaagaataagtaa

DBGET integrated database retrieval system