KEGG   Helicobacter cetorum MIT 99-5656: HCD_07895Help
Entry
HCD_07895         CDS       T02033                                 

Gene name
rplS
Definition
(GenBank) 50S ribosomal protein L19
  KO
K02884  large subunit ribosomal protein L19
Organism
hcm  Helicobacter cetorum MIT 99-5656
Pathway
hcm03010  Ribosome
Brite
KEGG Orthology (KO) [BR:hcm00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    HCD_07895 (rplS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:hcm03011]
    HCD_07895 (rplS)
Ribosome [BR:hcm03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    HCD_07895 (rplS)
  Bacteria
    HCD_07895 (rplS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L19
Motif
Other DBs
NCBI-ProteinID: AFI06566
UniProt: I0EUE7
LinkDB All DBs
Position
1673401..1673757
Genome map
AA seq 118 aa AA seqDB search
MKNRYIQQFEDAQLKGKTMPQFKAGDTLRLGITIKEGEKTRTQYFEGVCIAIRGNGVDRT
FCVRKMGANNIGVEKIFPFYSESLASVEVLRIGRVRRAKLYYLRDRRGKAARIKEVRK
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatcgctatattcagcaatttgaggacgctcagttaaagggcaagacaatgcca
caattcaaagcgggcgatactttaagacttggtatcaccattaaagaaggtgagaaaact
agaacgcaatattttgaaggggtgtgtattgctattaggggtaatggcgtggataggact
ttttgtgtgcgtaaaatgggggctaacaatatcggcgtggagaaaattttccctttttac
agtgagagtttggcgagtgttgaggtgttacgcattggtagagtgcgtcgtgcgaagctt
tattacttgcgtgatagaaggggtaaagcggctagaattaaggaagtgcgtaagtag

DBGET integrated database retrieval system