KEGG   Helicobacter pylori HUP-B14: HPB14_02970Help
Entry
HPB14_02970       CDS       T02035                                 

Gene name
ddl
Definition
(GenBank) D-alanyl-alanine synthetase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
hcn  Helicobacter pylori HUP-B14
Pathway
hcn00473  D-Alanine metabolism
hcn00550  Peptidoglycan biosynthesis
hcn01100  Metabolic pathways
hcn01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:hcn00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    HPB14_02970 (ddl)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    HPB14_02970 (ddl)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    HPB14_02970 (ddl)
Enzymes [BR:hcn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     HPB14_02970 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:hcn01011]
 Precursor biosynthesis
  Amino acid ligase
   HPB14_02970 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 GARS_A ATPgrasp_TupA RimK ATP-grasp_3 VitD-bind_III
Motif
Other DBs
NCBI-ProteinID: AFI07301
UniProt: I0EWI2
LinkDB All DBs
Structure
PDB: 

Position
complement(602708..603751)
Genome map
AA seq 347 aa AA seqDB search
MEFCVLFGGASFEHEISIVSAIALKGVLKDRIKYFIFLDENHHFYLIEESNMHSKYFAQI
KEKKLSPLILTHNGLLKNSFLGTKIIELPLVINLVHGGDGEDGKLASLLEFYRIAFIGPR
IEASVLSYNKYLTKLYAKDLGVKTLDYVLLNEKNRANALDLIGFNFPFIVKPSNAGSSLG
VSVVKEEKELIYALDSAFEYSKEVLIEPFIQGVKEYNLAGCKIKKDFCFSYVEEPNKQEF
LDFKQKYLDFSRNKAPKANLSNALEEQLKENFKKLYNDLFDGAIIRCDFFVIENEVYLNE
INPIPGSLANYLFDDFKITLENLVQSLPKPPKIQIKNSYLLQIQKNK
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
gtggagttttgcgttttatttggtggggcgagttttgagcatgaaatcagcattgtgagc
gcgatcgcgcttaaaggagtgttaaaggataggattaaatattttatttttttagacgaa
aaccatcatttttatttgattgaagaatccaacatgcattcaaaatacttcgctcaaatc
aaagaaaaaaaattatcccccctaatccttacgcacaatggcttgcttaagaactcgttt
ttaggcactaagataatagaattgcctttagtgatcaatcttgtgcatgggggcgatggc
gaagacgggaaattagcgagcttgttagaattttatcgtatcgcttttataggccctagg
attgaagcgagcgtgctgagttacaacaaatatttaaccaaactttacgccaaagattta
ggggtaaagactttagattatgtgcttttgaatgaaaaaaaccgcgctaacgccctggat
ttgattgggtttaatttccctttcattgtcaagcccagtaacgccggaagctccttaggg
gtgagcgttgtgaaagaagaaaaagaattgatttacgctttagacagcgcgtttgaatat
tctaaagaggtcttaatagagcctttcattcagggcgtgaaagaatacaatttggccggc
tgtaagatcaaaaaggatttttgtttttcttatgtggaagagcctaacaaacaggaattt
ttagatttcaaacaaaaatatttggatttttcacgcaataaagcccctaaagcgaacctt
tctaacgctttagaagaacaattaaaagaaaattttaaaaaactctataacgatttgttt
gatggcgcgatcatccgttgcgatttttttgtcatagaaaatgaagtgtatcttaatgag
atcaaccccattcctggcagtttggccaattatttgtttgatgattttaaaataacgcta
gaaaatttagtgcaatcattacccaaaccccctaaaatccaaatcaaaaactcttatttg
ttgcaaatccaaaagaataaataa

DBGET integrated database retrieval system