KEGG   Halomonas chromatireducens: LOKO_02557Help
Entry
LOKO_02557        CDS       T04292                                 

Gene name
gatB
Definition
(GenBank) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
hco  Halomonas chromatireducens
Pathway
hco00970  Aminoacyl-tRNA biosynthesis
hco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hco00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    LOKO_02557 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hco03029]
    LOKO_02557 (gatB)
Enzymes [BR:hco01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     LOKO_02557 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     LOKO_02557 (gatB)
Mitochondrial biogenesis [BR:hco03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    LOKO_02557 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AMD01617
UniProt: A0A109UMB3
LinkDB All DBs
Position
2722653..2724107
Genome map
AA seq 484 aa AA seqDB search
MQWETVIGLEVHVQLATRSKIFSGASTAFGAEPNSQACAVDLGLPGVLPVLNEAAVAMAV
QFGLAIHADIPEVSVFDRKNYFYPDLPKGYQTSQMYHPIVGAGEVEITLDDGSTKRIRVH
HAHLEEDAGKSLHEDFHGMTGVDLNRAGTPLLEIVSEPDLRSAKEAAAYLKAIHSIVTYL
GISDGNMAEGSMRCDVNVSVRPRGQEAYGTRAEIKNVNSFRFVERAIAFEVERQVELIED
GGKVVQETRLFDPDRDETRSMRTKEEANDYRYFPCPDLLPVVLDQAYVDHLRSNLPELPA
EKRARFEHELGLSAYDASVLSATREMADFFEEAKNVCGDAKQAANWVQGELSGALNRESL
PITHSPVSARQLGELIARVMDDTINGKAAKQVFQALWNGQGARADDIIEAQGLKQVTDSG
AIEAMIDQVIEESPAQVAQYRDAEPDKRGKMIGYFVGQVMKASRGTANPQQVNQLLKEKL
DALC
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgcaatgggaaaccgtgatcgggctggaggtccatgtccagctcgccacccgctcgaaa
atcttttccggcgcgtccacggccttcggcgccgagcccaacagccaggcttgcgccgtg
gacctgggcctgcccggcgtgctgccggtgctcaacgaggctgccgtggccatggccgtc
cagttcggtctggcgatccacgccgacattcccgaggtctcggtcttcgatcgcaagaat
tacttctaccccgacctgcccaagggctaccagaccagccagatgtatcaccccatcgtc
ggtgccggcgaagtggagatcaccctggatgacggcagcaccaagcgtatccgggtccac
catgcccacctggaagaggatgccggcaagtcgctgcatgaggacttccacggcatgacc
ggggtcgacctcaaccgggccggcaccccgctgctggagatcgtctccgaaccggacctg
cgctcggcgaaggaggccgccgcctacctcaaggcgatccactccatcgtcacctatctc
ggcatcagcgacggcaacatggccgaagggtcgatgcgctgcgacgtcaacgtctcggtg
cgcccccggggccaggaagcctacggcacccgcgccgagatcaagaacgtcaactccttc
cgcttcgtcgagcgcgccatcgccttcgaggtggagcgccaggtggagctgatcgaggat
ggcggcaaggtggtgcaggagactcgcctgttcgaccctgatcgggacgagacccgcagc
atgcgcaccaaggaggaagccaacgactatcgctacttcccctgccccgacctgcttccc
gtggtgctggatcaggcctatgtcgatcacctgcgcagcaacctgccggagctgcccgcg
gagaagcgcgcccgcttcgagcatgaactggggctttccgcctacgatgccagcgtgctt
tccgccacgcgggagatggccgacttcttcgaggaggccaagaacgtctgtggcgatgcc
aagcaggccgccaactgggtccagggcgagctttccggcgcactcaaccgggagagcctg
ccgatcacccacagtcccgtctcggcccgccagctcggcgaactgatcgcccgggtaatg
gacgacaccatcaacggcaaggccgccaagcaggtcttccaggccctgtggaacggccag
ggcgccagggccgacgacatcatcgaagcccaggggctcaagcaggtcactgacagcggt
gccatcgaggcaatgatcgatcaggtgatcgaggaaagtcccgcccaagtcgcccagtac
cgcgatgccgagccggacaagcgtggcaagatgatcggctacttcgtcggccaggtcatg
aaggcctcacggggcaccgccaacccccagcaggtcaatcaactgctgaaagagaagctg
gacgccctctgctga

DBGET integrated database retrieval system