KEGG   Halomonas chromatireducens: LOKO_03081Help
Entry
LOKO_03081        CDS       T04292                                 

Gene name
fadB_4
Definition
(GenBank) Fatty acid oxidation complex subunit alpha
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
hco  Halomonas chromatireducens
Pathway
hco00071  Fatty acid degradation
hco00280  Valine, leucine and isoleucine degradation
hco00281  Geraniol degradation
hco00310  Lysine degradation
hco00362  Benzoate degradation
hco00380  Tryptophan metabolism
hco00410  beta-Alanine metabolism
hco00640  Propanoate metabolism
hco00650  Butanoate metabolism
hco00903  Limonene and pinene degradation
hco00930  Caprolactam degradation
hco01100  Metabolic pathways
hco01110  Biosynthesis of secondary metabolites
hco01120  Microbial metabolism in diverse environments
hco01130  Biosynthesis of antibiotics
hco01200  Carbon metabolism
hco01212  Fatty acid metabolism
Module
hco_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:hco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    LOKO_03081 (fadB_4)
   00650 Butanoate metabolism
    LOKO_03081 (fadB_4)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LOKO_03081 (fadB_4)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LOKO_03081 (fadB_4)
   00310 Lysine degradation
    LOKO_03081 (fadB_4)
   00380 Tryptophan metabolism
    LOKO_03081 (fadB_4)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LOKO_03081 (fadB_4)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    LOKO_03081 (fadB_4)
   00281 Geraniol degradation
    LOKO_03081 (fadB_4)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LOKO_03081 (fadB_4)
   00930 Caprolactam degradation
    LOKO_03081 (fadB_4)
Enzymes [BR:hco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     LOKO_03081 (fadB_4)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     LOKO_03081 (fadB_4)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     LOKO_03081 (fadB_4)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     LOKO_03081 (fadB_4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AMD02128
UniProt: A0A0X8HGC3
LinkDB All DBs
Position
3286381..3288570
Genome map
AA seq 729 aa AA seqDB search
MIYQGNAISVARGTKTGGDDIAMLTFDLKGESINKLSSAVVTELGDAVKAIQSESGLKGL
VIGSAKDVFIVGADITEFHGLFDKGEEYLVEMNLKVHDIFNAIEDLPFPTVTAINGLALG
GGCEVTLTTDFRVMGEKAKIGLPETKLGILPGWGGCVRLPRMIGADNAIEWIAGGTENRA
DAALKMGAVDAVVPNESLEDAALDILARAYSGELDYQARRDEKTGPLKLNPIEQMMAFET
AKGYVKGKAGPHYPAPVEAIKVIQKGAGEERGRAQAIEAKAFAKLALSDIAFNLVGLFLN
DQVVKKKASKYEKQARPVKQTAVLGAGIMGGGIAYQSASKGTPILMKDIKEEAVELGLKE
SRKLFAKQVERKKLTTEQMAEKLTLIRPTLSYGDFGHVDLVVEAVVENPKVKDAVLTEVE
GLVGEETILTSNTSTISITRLAENLKRPENFCGMHFFNPVHRMPLVEVIRGEKTGDAAVA
ATVAYARAMGKTPIVVNDCPGFLVNRVLFPYFGGFSLLVEQGADFQRVDKIMEKFGWPMG
PAYLLDVVGMDTAVHAGEVMAEGFPERMGQMGGDGSKSAIQVMYENERLGQKNDKGFYAY
EEDKKGKPKKVSDDKAYELVKQVVKSEQEFSDEDIIARMMVPLCLETVRCLEDGIVETPA
EADMALIYGIGSPPFRGGALRYIDAMGIGEFVKLADGLADELGPLYAPTDKLRKMAEAGE
RFYTTQAQS
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgatttatcaaggcaatgccatctcggtggcacgcggtaccaagaccgggggcgacgac
atcgccatgctcaccttcgacctgaagggtgagtccatcaacaagctgtccagcgcggtc
gtgaccgagctgggcgatgccgtcaaggcgatccagagcgagagcggcctcaaggggctg
gttatcggcagcgccaaggatgtcttcatcgtgggtgccgatatcaccgaattccatggc
ctgttcgataagggcgaggagtatctggtcgagatgaacctcaaggttcacgacatcttc
aacgccatcgaggacctgccgttccccacggttaccgccatcaacggcctggcgctgggc
ggcggctgtgaagtcacgctgaccaccgatttccgtgtcatgggcgagaaggccaagatc
ggcctgcccgagaccaagctgggcatcctgccgggctggggtggctgcgtgcgcctgcct
cggatgatcggggccgacaacgccatcgaatggatcgccggtggtaccgagaaccgtgcc
gatgccgcgctcaagatgggtgccgtcgatgcggtggttccgaatgaatccctcgaagac
gccgcgctggatattctggcgcgtgcctacagcggcgaattggactaccaggcgcgccgg
gacgagaagacagggccgctcaagctcaatcccatcgaacagatgatggccttcgagacc
gccaagggctacgtcaagggcaaggcggggccgcactacccggcaccggtagaagcgatc
aaggtgatccagaagggcgccggcgaagagcgcgggcgggcccaggccatcgaggccaag
gccttcgccaagctggcgctgagcgatattgccttcaacctcgtggggctgttcctcaac
gatcaggtggtcaagaagaaggccagcaagtacgagaaacaggcccggccggtcaagcag
accgccgtgttgggtgcgggcatcatgggcggcggcatcgcctaccagagcgcctccaag
ggcacgccgatcctgatgaaggacatcaaggaagaggctgtcgaactaggtctcaaggag
tcgcgcaagctgttcgccaagcaggtggaacggaagaagctgaccaccgagcagatggcc
gagaagctgaccctgatccggccgaccctctcctacggcgactttggccacgttgacctg
gtagtcgaagccgtagtcgagaaccccaaggtcaaggacgcggtgctgaccgaagtggaa
ggcctggtcggcgaggagaccatcctcacctccaatacctccaccatttccatcacccgc
ctggccgaaaacctcaagcggcccgagaacttctgcggcatgcacttcttcaatccggtg
caccgcatgccgctggtcgaggtcatccgtggcgagaagaccggtgacgccgccgtggcg
gccaccgtggcctatgcccgcgccatgggcaagacccccatcgtggtcaacgattgcccc
gggttcctggtcaaccgggtgctgttcccctatttcggcggcttcagtctgctggtggag
cagggcgccgatttccagcgcgtcgacaagatcatggagaagttcggctggcccatgggt
cccgcctacctgctcgacgtggttggcatggataccgctgttcatgctggtgaagtgatg
gccgagggtttccccgaacgcatgggccagatgggcggtgacggaagcaagagcgccatc
caggtgatgtatgagaatgagcgcctgggccagaagaacgacaagggcttctacgcctac
gaggaagacaagaagggcaagccgaagaaagtcagcgacgacaaggcctatgagctggtc
aagcaggtggtcaagtcggagcaggagttctccgacgaggacatcattgcccgcatgatg
gtgccgctgtgcctggagaccgtgcgctgcctggaggatggcatcgtcgagacaccggcc
gaagcggacatggcgttgatctacggcatcggctccccgccgttccgcggcggtgcgctg
cgctacatcgacgccatgggaatcggtgagttcgtcaagctggccgatggcctggccgac
gagctggggccgctctacgcgcccaccgacaagctgcgcaagatggccgaagccggcgaa
cgcttctataccacccaggcccagagctga

DBGET integrated database retrieval system