KEGG   Halomonas chromatireducens: LOKO_03554Help
Entry
LOKO_03554        CDS       T04292                                 

Gene name
ahpF
Definition
(GenBank) Alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
hco  Halomonas chromatireducens
Brite
KEGG Orthology (KO) [BR:hco00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    LOKO_03554 (ahpF)
Enzymes [BR:hco01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     LOKO_03554 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 FAD_oxidored HI0933_like Glutaredoxin FAD_binding_3 AlaDh_PNT_C K_oxygenase FMO-like Thi4 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AMD02594
UniProt: A0A0X8HHA0
LinkDB All DBs
Position
complement(3774131..3775687)
Genome map
AA seq 518 aa AA seqDB search
MLDDNLKSQLQTYLQKVTQPFEIVASLDDGDKSQELFKLLEQIAGLSDKITLRSDGRDAR
TPSFALNRPGEDTGLVFAGIPMGHEFTSLVLALLQVGGHPPKVSDEVIEQIKSLDDELSF
ETYYSLSCQNCPDVVQALNLMAVLNPKVRHVAIDGALFQDEVEQREVMSVPSIYLNGEPF
DQGRMSLEQILAKVDTGAARREAAKLNEKPSYEVLMVGGGPAGAAAAIYAARKGIRTGVA
TERFGGQVLDTMAIENFISVSETNGPKLAAALEEHVKQYDVDIMPLQRAVKLVPATQPGG
EHEVVFESGASLKSRSLILATGARWREMGVPGEDEYRNKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGLVEHVTLIEFMDELRADAVLQKKLASLANVEVIKGARTTEVNGDG
KRVNGLTYEERSSGELRRLDLEGIFVQIGLVPNTEWLTDSSIELSPRGEIVVDDHGMTSV
PGIFAAGDVTTVPYKQIVIAMGEGSKAALGAFDYLIRL
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgacaatctgaagagccagctgcagacgtatttgcaaaaggtcacccaaccg
ttcgagatcgtcgcgtccctcgatgacggcgacaagtctcaggaactgttcaagctgctg
gagcagatcgccggcttgagcgacaagattaccctgcgcagcgatggtcgcgatgcccgc
acgccgtcgttcgccctgaaccgccccggggaagatacgggcctggtgttcgccgggata
cccatgggccacgagttcacctcgctggtattggccctgctgcaggtcggcggccacccg
cccaaggtctccgacgaggtgatcgagcagatcaagagcctggacgatgagctgagcttc
gaaacctactattcgctctcctgccagaactgccccgatgtggttcaggcgctcaacctg
atggcggtgctcaatcccaaggtgcgccatgtggccatcgacggagccctgttccaggac
gaggtggagcagcgcgaggtgatgtcggtaccgagcatctacctcaatggcgaacccttc
gaccagggccgcatgagcctcgagcagatcctggccaaggtcgataccggcgccgccagg
cgcgaggcggccaagctcaacgagaagccgtcctacgaggtgctgatggtcggcggcggc
ccggccggtgccgcggcggccatctatgccgcgcgcaagggcatccgcacgggggttgcc
accgagcgctttggcggccaggtcctcgacaccatggccatcgagaacttcatctccgtc
tcggagaccaacggccccaagctggcagccgcgctggaggagcacgtcaagcagtacgat
gtggatatcatgccgctgcagcgggccgtcaagctggtgccggccacacagcccggcggc
gagcatgaggtggtgttcgagtcgggcgcgtcgctcaagagccgctcgctgatcctcgcg
accggtgcccgctggcgtgagatgggcgtgcccggcgaggacgagtaccgcaacaagggt
gtggcctactgccctcactgcgatgggccgctgttcaagggcaagcgcgtggcggtgatc
gggggtggcaactccggcgtcgaggccgccatcgacctggccggcctggtcgagcatgtc
accttgatcgagttcatggacgagctgcgtgccgatgcggtgctgcagaagaagcttgcc
agcctggccaacgtggaggtgatcaagggagccaggaccaccgaggtcaacggtgacggc
aagcgggtcaacggcctcacctacgaggagcggtcaagcggcgagctgcgtcgactcgac
ctggagggcatcttcgtgcagatcggcctggtgcccaacaccgagtggctgaccgattcg
tcgatcgagctttccccgcgtggcgagatcgtcgtcgacgatcatggcatgacctcggtg
ccgggtatcttcgccgccggcgacgtcaccacggtgccctacaagcagatcgtcatcgcc
atgggcgaaggttccaaggcggcactgggtgccttcgactacctgattcgtctctga

DBGET integrated database retrieval system