KEGG   Helicobacter cinaedi PAGU611: HCN_1062Help
Entry
HCN_1062          CDS       T02034                                 

Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
hcp  Helicobacter cinaedi PAGU611
Pathway
hcp00440  Phosphonate and phosphinate metabolism
hcp01100  Metabolic pathways
hcp01120  Microbial metabolism in diverse environments
hcp01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hcp00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    HCN_1062
Enzymes [BR:hcp01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     HCN_1062
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase CTP_transf_like
Motif
Other DBs
NCBI-ProteinID: BAM12290
LinkDB All DBs
Position
complement(1078022..1079335)
Genome map
AA seq 437 aa AA seqDB search
MAADLIHPGHINILKIARELADSLESSEGRRGEVVLGLLTDKAIASYKRLPYMNYAQRYE
VISHLKEIDRVIPQDTLSYEGNIRSLKPRFVIHGDDWKSGTQSKTRQNVIDTLQELNCGE
LIEPSYTEGISSTQLNLDARAIGISTNARLSLLRRLVNAKTPLRICETHSAISALIAQNA
CVESSGKKLEFDGFWSSSLTDSTSRGKPDIEAVELTSRLNTINEIFEVTSKPLIYDADTG
GKIEHFVFSVRSLERTGVSAVIIEDKTGLKKNSLLGNDVEQTQEDIEVFCDKIRAGKNAQ
ITQDFMIIARIESLILDKGQEDALKRAFAYINAGADGIMIHSRQKSPDEVLAFLKAFREK
DSKTPVVVVPTSFNEITAKELGEAGANIIIYANHLLRASFIAMQKVSQGILEFDRSKEME
SSCMSVKEILSLIPGTI
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atggcggcagatttaatccaccccggacacattaatatcctaaaaatcgcaagagagtta
gccgatagcttagaatctagtgagggcagaaggggcgaagtcgtgctaggacttttgacc
gataaggcaatagcctcttataaacgactaccttatatgaactatgcccaacgctatgaa
gtcattagccatttaaaagagattgatagagttatcccgcaagatacattgagttatgag
ggcaatatccgctccttaaagcctcgcttcgtaatccacggcgatgattggaaaagcggc
acacagagtaaaacgcgtcaaaatgtcattgataccctgcaggagctaaattgcggtgag
cttatagagcctagctacacagagggcataagctccacacagctaaaccttgatgcaagg
gcgattggtatcagcacaaatgctagactttcgctcttacgccgacttgtgaatgcaaaa
actccacttagaatctgtgaaacccactccgctatatccgcccttatcgcacaaaatgct
tgtgtagaatctagcggcaaaaagctagagtttgatggcttttggagttctagccttaca
gatagcacaagcaggggtaagccagatattgaagccgtagagctaacaagccgcttaaac
accattaatgaaatctttgaagtaacctcaaagcccttgatttatgatgctgacacaggt
ggcaagatagagcattttgtcttttctgtgagaagtttggagcgaacgggagtatctgct
gtcatcattgaagacaaaacgggcttaaagaaaaattcacttttgggtaatgatgtagag
caaacccaagaagacattgaagtcttttgcgacaagattagagcagggaaaaacgcacag
attacacaggattttatgattatcgcgcgtattgaatctttgatactagacaaagggcaa
gaagatgcactaaaaagggcttttgcctatattaacgctggggcagatggtataatgata
cattcacgccaaaaaagccctgatgaagtgttagcttttctcaaagcctttagagagaaa
gattctaaaacgcctgtggtagtcgtgcctacaagctttaatgaaatcactgcaaaagag
ctaggggaagcaggggcaaatattatcatttatgcaaaccacttgcttagggcttcattt
atagcgatgcaaaaggtctcacaagggattttagagtttgatagaagtaaggagatggaa
tcttcttgtatgagtgtgaaggagattctctcacttattccggggacaatttag

DBGET integrated database retrieval system