KEGG   Helicobacter cinaedi PAGU611: HCN_1176Help
Entry
HCN_1176          CDS       T02034                                 

Definition
(GenBank) conserved hypothetical protein
Organism
hcp  Helicobacter cinaedi PAGU611
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DpnII
Motif
Other DBs
NCBI-ProteinID: BAM12391
LinkDB All DBs
Position
complement(1195724..1196155)
Genome map
AA seq 143 aa AA seqDB search
MGLDSNARKNRGGAFMESYLRDLFAKANLHFKKEVNIAEFSDLQRNFGDDKKRFDFVIFG
KNISYFIECNFYTSGGSKLNETARAYQELAPKFDGFADKNFIWITDGQGWHSSKNKLQEA
YKSVEMYNLNNVKDFIKKAQNDR
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
gtgggtttagatagtaatgcaaggaaaaatcgtggcggtgcttttatggaatcttattta
agagatctttttgcaaaggctaatttacactttaaaaaagaagtaaatattgcagagttt
agcgatttgcagagaaactttggagatgataaaaagcgatttgactttgtgatttttggg
aaaaatataagctattttattgagtgtaatttctatacgagtggcgggagtaagcttaac
gaaacagctagagcatatcaagaattagccccaaaatttgatgggtttgccgataaaaat
tttatatggattaccgatgggcaaggttggcacagcagcaaaaataaattgcaagaagcc
tataaaagcgtagagatgtataatctcaataatgtaaaagattttattaaaaaggcacaa
aatgaccgctaa

DBGET integrated database retrieval system