KEGG   Helicobacter cinaedi PAGU611: HCN_1269Help
Entry
HCN_1269          CDS       T02034                                 

Gene name
ddl
Definition
(GenBank) D-alanyl-alanine synthetase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
hcp  Helicobacter cinaedi PAGU611
Pathway
hcp00473  D-Alanine metabolism
hcp00550  Peptidoglycan biosynthesis
hcp01100  Metabolic pathways
hcp01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:hcp00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    HCN_1269 (ddl)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    HCN_1269 (ddl)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    HCN_1269 (ddl)
Enzymes [BR:hcp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     HCN_1269 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:hcp01011]
 Precursor biosynthesis
  Amino acid ligase
   HCN_1269 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 ATP-grasp
Motif
Other DBs
NCBI-ProteinID: BAM12480
LinkDB All DBs
Position
complement(1287960..1288997)
Genome map
AA seq 345 aa AA seqDB search
MKFDVIFGGVSFEHEISIVSAVALKKVLGERISNFIFLDSLHRFYLIPATLMKSKTFSSG
EYKKCTEIFLQRSSFVKKSLFGFKAIIPNTLISLIHGADGEDGSMSALLDFYHIPFIGPR
IESSVMSFNKALTKIYAQSRGVKVLDYEILTRNSPNPTLPYPLILKPSRLGSSIGVSVVN
KEDELEYAKDLAFEYDDSIVVECFKSGVKEYNLAGCKIGDEFRFSIVEEPSKKEMLDFEN
KYLDFSRTAQVLKADISQELEKQIQQNFAKLYENAFEGALIRCDFFVIDNEVYLNEINPI
PGSMANYLFEDFACVLESLAHNLPKKHSIKVSYKYIERIHHAKGK
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttgatgtaatctttggtggcgtgagctttgagcacgagattagcattgtgagt
gcggtggcgttaaaaaaggtgctaggggagagaatatcaaattttatttttttagattct
ttgcatagattctaccttattcccgcaacgctaatgaagtctaaaacttttagttcaggg
gagtataaaaaatgcacagagatttttttgcaaaggagttcatttgtaaaaaaatctctt
tttggctttaaggcgattatcccaaatacgcttattagccttatacacggagcagatggg
gaagatggcagtatgagtgcgttgcttgatttttatcatattccttttattggtccgcgt
atagaatctagtgtgatgagttttaacaaggctttgacaaagatttacgcacaatcaagg
ggcgtgaaagtgttagattatgagatactcactcgcaatagccctaatcccactttgccc
tatcctttgattttaaagccatctcgccttggaagctccataggtgtaagtgtagtaaat
aaagaagatgagctagaatatgctaaagatttagcatttgagtatgatgatagtattgtg
gtggagtgctttaaaagcggtgtgaaagaatataatttggctgggtgcaagataggtgat
gagtttagattctctatcgtagaagagccaagtaagaaagaaatgctagattttgaaaat
aaatatttggacttttctcgcacagcacaggttttgaaagctgatattagccaagagctt
gaaaagcagattcagcaaaattttgccaaactttatgaaaacgcttttgagggggcgttg
atccgttgtgatttttttgtgattgataatgaagtgtatttgaatgagattaatcccatt
ccggggtctatggcgaattatttatttgaagattttgcttgtgtgcttgaatctttggct
cataatttgccaaaaaaacattctatcaaggtaagctataaatatattgaacgcattcat
cacgcaaaaggaaagtaa

DBGET integrated database retrieval system