KEGG   Hippocampus comes (tiger tail seahorse): 109507545
Entry
109507545         CDS       T04969                                 

Gene name
pidd1
Definition
(RefSeq) p53-induced death domain-containing protein 1
  KO
K10130  leucine-rich repeats and death domain-containing protein
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04115  p53 signaling pathway
hcq04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109507545 (pidd1)
   04115 p53 signaling pathway
    109507545 (pidd1)
SSDB
Motif
Pfam: LRR_8 Peptidase_S68 ZU5 LRR_4 Death LRR_9
Other DBs
NCBI-GeneID: 109507545
NCBI-ProteinID: XP_019712603
LinkDB
Position
Unknown
AA seq 967 aa
MEKSSEEENSNDDDGDKAAGCRLEDEHLAVTPTSRYGDTDSSEILRKDSDRVYNEQLHSE
RRAGVQRHRDEGDAVSVSDSCFMDTCNPSISSLSSSSFSSVLCLTPPLPPSVELSAVLTD
TRLTLDVYLGGAAALALLWGSIPGHLKGLRYLRLGSEDKPALEGALCVLPHLTELHSLAI
RGRCVYDAQGNPLPGLLTTLPNSLNSLCLLVHVDLSFNQLSVLPSCLLSLPSLSALLLCH
NCFSELPPNIGQLSSLTYLSLIGNKLVSLPASLGQLKELQTLDVSDNLLEELPNEIGSLG
ELKKLELSHNKLKRLPETMGSLRSLRELFIFSNELHFIPPCLNDLPLLKIDVRDNPLGQP
PTPPPLPLATDEAEPNIPELHLLFNQHRFSVTSAGCHVFLPGGTQLLFPPGCLQSPTILE
WAERRPQRKWVLLEEHDILLSRPLELRPHGITFLKPVEVCMAHHRKKWKEAVVRKYDGTS
WNTLPTSVRKGREKHSIHFLGRPTRLACCSVSQFSWFIVVARPVRDSCSVSPAGAFLVSS
ADPRVKLIFPPDSTSQTRTITLQVLQVSVSEVQALCADPQASVSPLLCLSQTPSMHFLQP
VKVQVPLPPGVTGHTVDKSCLYLLHGDPTAQTWTDITSQVSLYVTHLYAIFYITHFSWYW
LWYKTQSCVSGMVRKVYQRLKQFKVQFMVLQRKTDPSQVLLQCLPANKVEDRVQSLSEQY
DGPQPSDLCDLLEGEQFFAGFERGLDICTDRPDCVGGRLCFVFYSNLKNLKEVYISPAKG
LRAPVRGEVSFYRGDIPSGLPEEVVRKRKGHDSQWLATLPLRLPALDADNKYIPEELQLP
PLNLGDPESGYLTEANLLSISLQIGQDWRVIGINLGLSYQELDRIQYKYRDNLGALVLDM
LFHWAQGQKSAGPGAVSRLTAAMIESGRRDLADELEDIVSLGKQKYTESLRRVGLEAEGQ
PLCESHQ
NT seq 2904 nt   +upstreamnt  +downstreamnt
atggagaaaagcagcgaggaagagaacagcaacgatgacgacggagataaagctgctggt
tgtagattggaagatgagcatttagcagtgacacctacgtccagatatggagatacagac
tcttctgagattttaaggaaggactcggatcgtgtctacaatgagcagctgcattcagag
aggagagccggagttcagagacatcgtgatgagggagatgctgtctcagtgtcagattcc
tgtttcatggacacctgcaatccttccatatccagtctttcgtcgtcgtccttctcctct
gtgctatgtctcacaccacccttacctccctctgtggagctttcagccgtgttgactgat
accaggctgacactggatgtctatctggggggagcagctgcattggcgctgctatggggt
tccattccagggcacctcaaggggctccggtacctgagacttggttctgaggataaacct
gcactggagggtgccctgtgtgtcctcccccatttgacagaactacactcacttgccata
cgagggcgctgcgtttatgatgcacaaggaaaccccttgcctggcctcctcaccactttg
cccaattccctcaactcactctgtcttttggtgcacgtggatctttccttcaaccagctc
tccgtccttccatcgtgtcttctcagcttaccttcgttgtccgccttgctcctgtgtcac
aactgcttctcggagctgccccctaatataggccagttgtccagcctcacctatctctcc
ctcattggaaataagctagtttctctgcctgcgagtttaggccagctaaaagagctacag
acactggatgtttcagataacctccttgaggagctgccgaatgaaattggttctctggga
gagctgaaaaagctcgaattgtcccacaacaagttgaagagactaccagagaccatgggc
tctctccgttccctgagggagcttttcatcttcagcaatgaactccacttcatcccacct
tgccttaatgatttgccgttgttgaaaatagatgttcgtgataatcctttggggcaaccg
ccgactcctccacccctcccccttgcaactgatgaagcagaaccaaatattcctgagttg
catctgctattcaaccagcacagatttagtgttacgtctgctggatgtcatgtgtttctc
ccaggggggacgcagctgctgttccccccggggtgcctgcagtcaccaacaatcttggag
tgggcagagaggagacctcagcgaaagtgggtgttgctcgaggagcatgacattctcctc
agtcgcccactggaacttcgtcctcatggcattacatttcttaagccagtcgaggtatgt
atggcacatcaccgcaaaaaatggaaggaggcggtggtacggaagtatgatggaacttca
tggaacactttacctacttctgtcagaaaaggacgtgagaagcacagcattcacttcttg
gggcgtccaaccaggctggcctgctgttccgtgagccagttttcatggtttattgtggtc
gcccgtccagtgagagacagctgctcagtttcaccagcaggagcctttctagtgtccagc
gctgaccctagagtcaagcttatcttccctccagactccaccagtcaaactcgcactata
actttacaggtgctccaggtgtcagtgtcagaggttcaggcgctgtgtgctgatccacaa
gcgagtgtcagtcctctcctctgtctctcacaaactcccagcatgcatttcctacagcca
gtcaaagttcaagtccctctgccaccaggggttacaggtcacactgttgataagtcgtgt
ttgtatctgctgcatggagaccccactgcccaaacctggacagacatcacctcacaagtg
tctctctatgtcacccacttgtatgccattttctacatcacacatttctcctggtactgg
ctgtggtacaagactcagagttgtgttagtggcatggtaagaaaggtctaccaaaggctg
aagcagtttaaagtccagttcatggttctccagcggaaaacggacccttctcaagtcctg
ctgcagtgtttaccagctaacaaggtggaagacagagtgcagtcactgtcagagcagtac
gatggaccccagccttcagatctatgtgaccttctggaaggagaacagttctttgccggc
tttgagagaggcttggatatctgcacagacagaccagactgtgtcgggggaagactgtgt
tttgtgttttactccaacctgaagaatctgaaggaagtttacatctctcctgcaaagggc
ctccgggctccagtgagaggagaagtctctttttacagaggggacattcccagtggtttg
ccagaggaagtagtgaggaagagaaaaggacatgacagccaatggcttgcaactttacca
ctaagacttcctgcattagatgctgacaacaagtacataccggaagagctccagcttcct
cccctgaacctcggagaccctgagagtggctacctgacagaagccaatctgctgtccatc
tctctccagattggacaggattggcgcgttattggcatcaatctcggtttaagctaccag
gagttagaccgcatccaatacaaatacagggacaatcttggagctctggtgctggacatg
ctcttccactgggcccaaggacagaaaagcgccgggcctggggcggtgtcacgattgacg
gccgccatgattgaaagtggcaggagggaccttgcagatgagctggaagacatagtcagt
ctgggaaagcaaaaatacacggagtcactgaggagagtaggcctggaggcggagggacag
cccctctgtgaaagccaccagtag

DBGET integrated database retrieval system