KEGG   Hippocampus comes (tiger tail seahorse): 109507632
Entry
109507632         CDS       T04969                                 

Gene name
cd82
Definition
(RefSeq) CD82 antigen
  KO
K06509  CD82 antigen
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109507632 (cd82)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hcq04147]
    109507632 (cd82)
   04090 CD molecules [BR:hcq04090]
    109507632 (cd82)
Exosome [BR:hcq04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109507632 (cd82)
  Exosomal proteins of other body fluids (saliva and urine)
   109507632 (cd82)
  Exosomal proteins of colorectal cancer cells
   109507632 (cd82)
CD molecules [BR:hcq04090]
 Proteins
  109507632 (cd82)
SSDB
Motif
Pfam: Tetraspanin DUF1310
Other DBs
NCBI-GeneID: 109507632
NCBI-ProteinID: XP_019712788
UniProt: A0A3Q2YJC4
LinkDB
Position
Unknown
AA seq 256 aa
MAKGCITVTKYFLFLFNLIFFVFGALIMGFGLWVLFDNQSFIAVLQESSDTVKVASYIFI
GVGSLSMAMGFFGCIGAIYEIRCLLGLYFTCLLLILIAQVTAGVLIYFQRDRLKHEMSNI
IQGMIVHYTGQNKTTEHTWDYIQRTMKCCGWTGPGNWSDNLLLKNSSQHLYSCSCRNESL
PGTDIKVEGLCEHLSSDLPVYQTGCMTNVEKWLLENCGVILGICVGVAVVELLGMILSMC
LCKSVVQEDYTKVPKY
NT seq 771 nt   +upstreamnt  +downstreamnt
atggcaaagggatgcatcaccgtcaccaagtactttctcttcctgttcaatctcattttc
tttgtctttggagcgttgatcatgggctttggactatgggttctatttgataatcagagt
ttcatcgctgttctacaggaatcgtcagacacggtaaaagtggcttcctacatcttcatc
ggagtggggtccttgtcaatggccatgggcttcttcggctgcattggggccatctatgaa
attcgttgtcttcttggtctgtacttcacctgtctgctgctcatccttatcgcccaagtg
accgctggagttctcatctacttccaaagagatcggttgaaacatgaaatgtccaacatc
atccaaggcatgatcgtccactacactggccagaacaaaaccacagagcacacttgggac
tacatccagaggacgatgaagtgctgtgggtggacggggcctggcaactggtctgacaat
ctgctgctcaagaacagctcccagcatctctattcgtgttcctgtcgtaacgagtccttg
cccggcactgacatcaaggtggagggcctgtgcgagcacctgtcctctgatcttcccgtc
taccaaacggggtgcatgaccaatgtggagaaatggcttctggagaactgcggcgttatt
ctgggaatctgtgtcggagtggcagtcgtggagcttcttgggatgatcctctccatgtgt
ttgtgcaagagtgttgtccaggaagattacaccaaagtacccaagtactga

KEGG   Hippocampus comes (tiger tail seahorse): 109514393
Entry
109514393         CDS       T04969                                 

Definition
(RefSeq) CD82 antigen-like
  KO
K06509  CD82 antigen
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109514393
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hcq04147]
    109514393
   04090 CD molecules [BR:hcq04090]
    109514393
Exosome [BR:hcq04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109514393
  Exosomal proteins of other body fluids (saliva and urine)
   109514393
  Exosomal proteins of colorectal cancer cells
   109514393
CD molecules [BR:hcq04090]
 Proteins
  109514393
SSDB
Motif
Pfam: Tetraspanin
Other DBs
NCBI-GeneID: 109514393
NCBI-ProteinID: XP_019723021
UniProt: A0A3Q2Z2A8
LinkDB
Position
Unknown
AA seq 255 aa
MGKGCVTAIKYFLFLFNLIFFLLGAVIMGFGLWLLLDNQSFIVVLNDSIAVKAACYILIG
VGTFAMLLGFLGCLGAIYEIRCLLGLYFTCLLLILIAEIVAGALIYFQKGVLNEEMSKIV
SKVLDNYPGNNSTTEQAWDFIQRNMECCGWNGQSDWNGNMVIINSSQLLFPCSCRNSSLA
TGNVSESGFCEAQTPDWPVYDTGCAVSVESWLLTNIGVVLGICIAIAFIELLGMILAICL
CKNIHREDYTKVPKY
NT seq 768 nt   +upstreamnt  +downstreamnt
atggggaaaggctgcgtgacggcgatcaagtacttcctgttcctcttcaacctcattttc
tttcttcttggggccgtcatcatgggctttggattgtggctcctcctggacaatcagagc
ttcatagttgtactcaatgactccatagctgtcaaggctgcgtgctacatcctgattgga
gtcggcacttttgctatgcttttgggcttcctcggctgcttgggagctatttatgagatc
cgctgtctgcttggcctttacttcacctgcctcttgttgatcctcattgctgagattgta
gctggcgccctcatctacttccagaagggtgtgttaaatgaagagatgtccaagattgta
tccaaggtcctggacaactatccaggcaacaactcgaccacagagcaggcgtgggacttc
attcaacgaaatatggaatgctgtggctggaatggtcaaagcgactggaacggaaacatg
gtgatcatcaacagttcgcagcttctgtttccgtgctcgtgccgcaactcctccctcgcg
accggaaacgtctccgagagcggattctgcgaagctcagacacccgactggcccgtatac
gacacgggttgcgctgtcagcgtagagagctggctcctcaccaacatcggggttgtcctg
ggaatctgtattgcaatcgcttttattgagctgctggggatgattctggccatctgcttg
tgcaagaatattcacagggaggactacaccaaagtgccaaagtactaa

DBGET integrated database retrieval system