KEGG   Hippocampus comes (tiger tail seahorse): 109508060
Entry
109508060         CDS       T04969                                 

Definition
(RefSeq) apoptosis regulator BAX-like
  KO
K02159  apoptosis regulator BAX
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04115  p53 signaling pathway
hcq04141  Protein processing in endoplasmic reticulum
hcq04210  Apoptosis
hcq04217  Necroptosis
hcq05132  Salmonella infection
hcq05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    109508060
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109508060
   04217 Necroptosis
    109508060
   04115 p53 signaling pathway
    109508060
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109508060
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109508060
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hcq03029]
    109508060
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hcq02000]
    109508060
Mitochondrial biogenesis [BR:hcq03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    109508060
Transporters [BR:hcq02000]
 Other transporters
  Pores ion channels [TC:1]
   109508060
SSDB
Motif
Pfam: Bcl-2 YesK Bcl-2_3 HEPN_AbiU2
Other DBs
NCBI-GeneID: 109508060
NCBI-ProteinID: XP_019713447
UniProt: A0A3Q2YSR4
LinkDB
Position
Unknown
AA seq 204 aa
MSENRGKENNDEEQLQGAVGGEDVIDDPILEQGAIVLRGYVIERINTEDPSRHVTSEDLG
GQSNEQQEPQIKEVVEQLIKIADELNKNAELQRLINQVQANCAQDIFMKVARSIFADGIN
WGRVVALFHLAYKLIYKALTTNHLENIRLIISWVLQVIREQLYYWLVQQGGWEGVIQGWS
HWRTFTLVASMILVATIVYYRRTR
NT seq 615 nt   +upstreamnt  +downstreamnt
atgtctgagaaccgaggaaaggagaacaacgacgaagaacaacttcaaggtgccgtaggt
ggggaagatgtcattgatgatcccatcctcgagcaaggagcaatagtcctcagagggtat
gtgattgagcgaatcaatacagaagaccccagtcgacatgttacctctgaggatttaggt
ggacaatcaaatgaacaacaggagccacaaatcaaagaagttgtggaacagctcatcaag
attgcagatgagttgaacaagaatgcagagctgcaacgactcatcaatcaggttcaagca
aactgtgctcaggatattttcatgaaggtggccaggagcatctttgctgatggcatcaac
tggggtcgagttgtggctctcttccatctagcatacaaactcatatacaaggccctgacc
acgaatcatctcgagaatatcagactcataatcagctgggttctccaggttatcagagag
caactctactactggcttgtccagcagggaggctgggaaggtgttatccaaggatggtct
cactggcggacattcaccttagtggcatcgatgattttagtggcaaccattgtttattat
aggcgaacacgctga

KEGG   Hippocampus comes (tiger tail seahorse): 109508612
Entry
109508612         CDS       T04969                                 

Definition
(RefSeq) apoptosis regulator BAX-like isoform X1
  KO
K02159  apoptosis regulator BAX
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04115  p53 signaling pathway
hcq04141  Protein processing in endoplasmic reticulum
hcq04210  Apoptosis
hcq04217  Necroptosis
hcq05132  Salmonella infection
hcq05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    109508612
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109508612
   04217 Necroptosis
    109508612
   04115 p53 signaling pathway
    109508612
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109508612
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109508612
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hcq03029]
    109508612
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hcq02000]
    109508612
Mitochondrial biogenesis [BR:hcq03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    109508612
Transporters [BR:hcq02000]
 Other transporters
  Pores ion channels [TC:1]
   109508612
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 109508612
NCBI-ProteinID: XP_019714207
UniProt: A0A3Q2XPL7
LinkDB
Position
Unknown
AA seq 202 aa
MACEGNGISDERIGEALIKEVIEEELKDVPSEDIPPLTPLAVEVRSSQEQKIVTQLGKMI
RIIGDRVKEDKEFQDAIDGVGCVEGSKWENFKRVADKVFEQGITWERIAVLFYVAGRLAF
KMVEAHLPQSVKEILIWTVDFFRNNLLSWIREHGGWINSFSELATSSMRTVGLNSQLYSL
VIIFCGGLAVGSFITWKLTRHS
NT seq 609 nt   +upstreamnt  +downstreamnt
atggcgtgtgaaggaaacggtatatcagatgagaggatcggagaagccctgataaaggag
gtcattgaggaagagctgaaggatgtgccctcagaagatatccctcctctcactcccctg
gctgtggaagtaagaagtagtcaggagcagaagattgtgacgcagttgggcaaaatgatc
cgaataattggcgacagggtcaaagaagacaaagaattccaggatgcaattgatggtgta
ggctgtgtggaaggatccaagtgggaaaatttcaagagagtggcagacaaagtctttgag
caaggcattacctgggagagaattgctgtgctcttctatgttgctgggaggttagcattc
aagatggttgaggctcatctcccgcagtcagtgaaggagatcctgatttggactgtggat
ttctttcgaaacaacctactaagctggattcgggaacatggtggatggatcaacagtttc
tctgagttggcaacatcctccatgcggaccgtgggactgaactcccaactctacagcctc
gtcatcatcttctgcggtggcctcgctgtaggaagttttatcacctggaagctgaccaga
cactcctga

KEGG   Hippocampus comes (tiger tail seahorse): 109519324
Entry
109519324         CDS       T04969                                 

Gene name
bax
Definition
(RefSeq) apoptosis regulator BAX
  KO
K02159  apoptosis regulator BAX
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04115  p53 signaling pathway
hcq04141  Protein processing in endoplasmic reticulum
hcq04210  Apoptosis
hcq04217  Necroptosis
hcq05132  Salmonella infection
hcq05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    109519324 (bax)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109519324 (bax)
   04217 Necroptosis
    109519324 (bax)
   04115 p53 signaling pathway
    109519324 (bax)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109519324 (bax)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109519324 (bax)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hcq03029]
    109519324 (bax)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hcq02000]
    109519324 (bax)
Mitochondrial biogenesis [BR:hcq03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    109519324 (bax)
Transporters [BR:hcq02000]
 Other transporters
  Pores ion channels [TC:1]
   109519324 (bax)
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 109519324
NCBI-ProteinID: XP_019731333
LinkDB
Position
Unknown
AA seq 192 aa
MAAHPGGGGQGDSKEQILELGAVLLKDFIYERVRRHGDNSAVVTRAQLGGGEICDTSHKR
LAQCLQKIGDELDGNVELQQMINSPSLRPTKEVFVKVAVEIFADGKFSWGRVVTLFYLAC
RLVIKALLTQVPDVIRTIINWTIDYLREHFLNWIWEQGGWESIRSYFGTPTWQLVAVFMA
GVIATIIVTRKM
NT seq 579 nt   +upstreamnt  +downstreamnt
atggcagcgcacccgggtggaggaggacaaggcgactccaaggagcagatactggaactg
ggggctgtcttgttaaaagatttcatttacgagcgagtccgccggcacggagacaacagc
gccgtcgtgacccgggcccagctgggtggaggcgagatatgcgataccagccacaagagg
ctggcccagtgcctacagaagattggagacgagctggacggcaatgtggaactccaacag
atgatcaactccccctcgctgagacccaccaaggaggtgtttgtgaaagtggctgttgag
atcttcgccgacggaaagttcagctggggccgagttgtcactctcttttacttggcctgt
cgactagtcatcaaagcgctcttgactcaagttcccgacgtcatcagaaccatcatcaac
tggaccatcgactacctccgtgaacactttctcaactggatctgggagcaaggaggctgg
gagagcattcgctcttactttggcactccgacgtggcaactggtggctgtgttcatggca
ggggtcatcgccacgataatcgtgactcgtaaaatgtga

DBGET integrated database retrieval system