KEGG   Hippocampus comes (tiger tail seahorse): 109508419
Entry
109508419         CDS       T04969                                 

Definition
(RefSeq) transcription factor p65-like isoform X1
  KO
K04735  transcription factor p65
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04010  MAPK signaling pathway
hcq04137  Mitophagy - animal
hcq04210  Apoptosis
hcq04218  Cellular senescence
hcq04620  Toll-like receptor signaling pathway
hcq04621  NOD-like receptor signaling pathway
hcq04622  RIG-I-like receptor signaling pathway
hcq04623  Cytosolic DNA-sensing pathway
hcq04625  C-type lectin receptor signaling pathway
hcq04920  Adipocytokine signaling pathway
hcq05132  Salmonella infection
hcq05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109508419
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    109508419
  09143 Cell growth and death
   04210 Apoptosis
    109508419
   04218 Cellular senescence
    109508419
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109508419
   04621 NOD-like receptor signaling pathway
    109508419
   04622 RIG-I-like receptor signaling pathway
    109508419
   04623 Cytosolic DNA-sensing pathway
    109508419
   04625 C-type lectin receptor signaling pathway
    109508419
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    109508419
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109508419
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109508419
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hcq03000]
    109508419
Transcription factors [BR:hcq03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    109508419
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 109508419
NCBI-ProteinID: XP_019713936
UniProt: A0A3Q2XSB2
LinkDB
Position
Unknown
AA seq 627 aa
MASVYGWPMNALNPVQTASPFIEIIEQPKQRGMRFRYKCEGRSAGSIPGEKSNDTTKTHP
AIKVHNYSGPLRVRISLVTKNTPYKPHPHELVGKDCKHGYYEADLQERRIHSFQNLGIQC
VKKKDVIEAITCRLQTNNNPFNIHEAKVWEEEFDLNSVRLCFQASITLPSGELFPLEPVV
SQPIFDNRAPNTAELKICRVNRNSGSCKGGDEIFLLCDKVQKEDIEVRFFQDSWEGKGTF
SQADVHRQVAIVFRTPPYRDTNLSEPVRVKVQLRRPSDREVSEPMDFQYLPADRDEYRWN
EKRKRTGDMFQSLKLGSLLSTRSIPPPDRRHFSPARRTAPTKAPPMMAPAFPPAASGAKA
QPSFTHMQPSQMFSGQTKVEASPCSFSSSPSTFSSSPSSNSVAATSQTWKIMESLNLGPQ
PQAIRVSGCSANHPPVSSQDYPTVNLSDLQEFFPSISSVVTQEAPASQGSAAPSQSSGFF
PLLGSQFPADASAVEEGIPQFPSFSEAQASGTLDSLDMDDFVDLLNPPDESGNGQQAGHS
AAAAMAAAQNASDPAGNPGSTWMNYPNSIVNLLQNESMMDVLTNNGNNPQRPAVLDEFDE
LISVDEDHLISIFNSGSQAGFVSGHPT
NT seq 1884 nt   +upstreamnt  +downstreamnt
atggccagtgtgtacggatggccaatgaacgcgctcaacccagtccaaacagcgagcccc
ttcatcgagatcatcgagcagccgaagcagcgcgggatgcggttccgatacaagtgcgag
gggcgctccgcgggcagcatacctggggaaaaaagcaacgacaccaccaagacccacccg
gccattaaggtgcacaactacagcggccccctgcgtgttcggatctccctggtgacaaaa
aacacgccgtacaagcctcatccgcacgagctggtcggaaaagactgcaagcacggctac
tacgaggccgacctgcaggagaggcggatacacagttttcagaacttgggcattcagtgt
gtgaagaagaaggatgtgattgaggccatcacatgtcggctgcagactaacaacaaccct
ttcaacattcacgaggccaaggtgtgggaggaggaatttgacctgaattcggtgcggctc
tgcttccaggcctccatcacgctgccttcgggggagctgttccccctggagcccgtcgtc
tcgcagcccatctttgacaacagggctccaaacacagcagagctgaagatctgcagagtg
aaccgtaactcgggcagctgcaaaggcggcgacgaaatctttctactctgcgacaaagtc
caaaaagaggacatcgaggtgcgcttcttccaggactcctgggagggcaagggaactttc
tcgcaggccgacgtccacaggcaggtggccatcgtgttccgcacgccgccataccgcgac
accaacctcagcgagcccgtccgcgtcaaggtgcagctgcgccgaccctcggaccgcgag
gtcagcgagcccatggacttccagtacctgcccgccgaccgggacgaataccggtggaat
gagaagcgcaagcgcaccggcgatatgttccagagtctgaaactgggatctctgctgtct
acaaggtcaattccaccacccgatcgcagacacttcagtcccgccaggaggacggcccca
accaaagctccgccgatgatggcgccagcttttccacctgctgccagcggggccaaggcg
cagccctccttcactcacatgcagcccagccagatgttctcgggccagaccaaggtggag
gcgtccccctgctccttctcctcctccccctccacattctcctcctccccgtcttccaat
tccgtcgcagccacgagccaaacgtggaagatcatggagagcttgaacctgggcccgcag
ccccaagccatccgggtttcgggttgctccgccaaccacccgcctgtttccagccaggac
taccccaccgtcaacctgtcagaccttcaggaattcttccccagcatcagctcggtcgtc
acccaagaggcgccggcctcgcaggggagcgccgccccctcgcagtcctccggcttcttc
cccttactgggctctcagttcccagcggacgccagcgcggtggaggagggcattccgcag
ttccccagcttttcggaagcccaggcctcaggaaccctggacagcctagacatggacgac
tttgtggacctcctgaatccgccggacgaaagcggcaacggccagcaggccggccactcg
gcggcggcggcgatggccgcagcgcagaacgcttcggacccggccggcaacccgggaagc
acctggatgaattatcccaacagcatcgtcaacctgctccagaacgagagcatgatggac
gtcttgaccaacaacggcaacaacccgcagcggcccgccgtgctggacgagtttgacgag
ttgatttccgtggatgaggatcatctcatttccatttttaacagcggaagccaagccggt
tttgtttcgggacaccccacttaa

DBGET integrated database retrieval system