KEGG   Hippocampus comes (tiger tail seahorse): 109508904
Entry
109508904         CDS       T04969                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1-like
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04012  ErbB signaling pathway
hcq04068  FoxO signaling pathway
hcq04110  Cell cycle
hcq04115  p53 signaling pathway
hcq04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    109508904
   04068 FoxO signaling pathway
    109508904
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109508904
   04115 p53 signaling pathway
    109508904
   04218 Cellular senescence
    109508904
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 109508904
NCBI-ProteinID: XP_019714393
LinkDB
Position
Unknown
AA seq 145 aa
MALDTPSTSITESEISRLGGVEALRLKVGPVRRNLFGPVDHQQLREDFQRLLCMNIEAAN
KRWNYDFVSDTPGTGSNVLWEEVRCQDVPGFYRGGVARSGKPVRRSSTSSGERSPTSSSS
SGSGDEYLEVTAREYYRLQRPEKRR
NT seq 436 nt   +upstreamnt  +downstreamnt
atggcgctggacacgccatcaacgtcaataaccgagtcagaaatctcgcgcctgggcggc
gtggaggccctgaggttgaaggtgggtccggtgcggaggaacctcttcggccccgtggac
caccagcagctgcgtgaggacttccagcgcctgctgtgcatgaacatcgaggcggccaac
aagcgctggaactacgacttcgtcagcgacacgccaggaaccggatccaacgtcctgtgg
gaggaggtccgctgccaggatgtaccgggcttctaccgcggtggcgtggcgcggtcgggc
aagcccgtgcgccggagctccacctcgtcgggcgagaggtccccgacgtccagcagctct
tccggatccggggatgagtacctggaagtgactgccagggagtactaccggctacaacgg
ccagaaaaacgcagac

DBGET integrated database retrieval system