KEGG   Hippocampus comes (tiger tail seahorse): 109509755Help
Entry
109509755         CDS       T04969                                 

Gene name
sod1
Definition
(RefSeq) superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    109509755 (sod1)
Enzymes [BR:hcq01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     109509755 (sod1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 109509755
NCBI-ProteinID: XP_019715157
LinkDB All DBs
Position
Unknown
AA seq 162 aa AA seqDB search
MQQTISNKMALKAVCVLRGTGETSGTVYFQQESEFSPVKLTGQIDGLTPGEHGFHVHTFG
DNTNGCISAGPHFNPLQKNHAGPNDPDRHVGDLGNVTAGADKVAKIDITDSVISLTGPNS
IIGRTMVIHEKADDLGRGNNEESLKTGNAGGRLACGVIGITQ
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaaactatctcgaacaaaatggcgcttaaagccgtttgtgtgctgagaggaacc
ggtgaaaccagcggaacggtgtatttccagcaggagagcgagttcagccctgtgaagctg
acgggacaaattgatggcctcacaccaggcgagcacggcttccacgtccacacctttgga
gacaacacgaacgggtgtatcagtgctggccctcacttcaacccgctccagaaaaatcac
gccggtccgaacgatccagataggcatgtcggcgacctgggcaacgtgaccgcgggtgct
gataaggtggccaaaatcgacatcacagacagtgtgatctccctcaccggcccaaactca
attattggcagaaccatggtgatccacgagaaggcagacgacttgggcagaggtaacaac
gaggagagcttaaagacgggtaacgccggcggacgtctggcttgcggcgtcatcggcatc
acccagtaa

DBGET integrated database retrieval system