KEGG   Hippocampus comes (tiger tail seahorse): 109509805
Entry
109509805         CDS       T04969                                 

Definition
(RefSeq) sestrin-2-like isoform X1
  KO
K20394  sestrin 2
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04115  p53 signaling pathway
hcq04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    109509805
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109509805
SSDB
Motif
Pfam: PA26 CMD
Other DBs
NCBI-GeneID: 109509805
NCBI-ProteinID: XP_019715220
UniProt: A0A3Q3E7L4
LinkDB
Position
Unknown
AA seq 548 aa
MASDTETGFGWRANGDSAPGPGPDSDDGRGGTTMKTLARLCSRDEEERAAALEELSQGVL
VCLGLDRPGSTRLGKETLLHLLRLARSCPLRDVRSRATELLRAAQEQGVEIPRALASGPS
AFIPAKQILKDGPDQDILIESFLSLGRVDHVTMVMALHPAYLSCFLRTQHALLEMDGPLP
RHWRHYITIMAAARHHCSYVVQQHSASFLEAGGDESWLSGLQNAPPKLRGLNPLNKLLAH
RPWLITQLHIQELVYPGAELRWSLAELIHAVILMTHAHALCSFVWGCGLNPEPDHAGGHT
FRPPSPGHPTRSPQSPANEDGRQELVDGAVEVEVLMKRMVELQEQQEEECTQEEMVTRFE
RERSESIPTALVRGAPPERLLHLMEDPDFRYEDFAPRGEQAPPTMRAQDYSWEDHGYSLV
NRLLPDMGQLLDEKFQVVSNMTYHRMAMHEGVDTHTLRKALWNYIHCLYGIRYDDYDYGS
VNVLLERSLKVFIKTMACHPEQTTGHIYHAFWRHFRHSEKVHANLIVLEARLQAALLYTL
RAITHYMR
NT seq 1647 nt   +upstreamnt  +downstreamnt
atggccagcgacactgaaacaggatttggatggcgggccaacggggacagcgcaccaggc
ccggggcccgactccgacgacggccgaggagggacgactatgaagaccctggcgcggctg
tgtagcagagacgaggaggaacgggcggcggctctggaggagctcagccaaggggttctg
gtgtgtctgggtctggaccggccgggttcgacgcggctgggcaaggagacgcttctgcat
ctgctgcggctggcccggtcctgtccgttgcgggacgtgcgatccagggccaccgagctg
ttgcgggccgcacaggagcaaggagttgaaattcctcgcgccctggcctcgggtcccagt
gcctttattcctgccaaacagatcttaaaagatgggccggaccaggacatcctgatcgag
tcgttcctgtctctgggccgcgtggaccacgtcaccatggtgatggcgctgcaccccgcc
tacctcagctgctttctgaggacccagcatgccttgctggagatggacggccccctgcct
cgccactggagacactacatcaccatcatggccgccgcccgccaccactgctcctacgtg
gtacagcagcacagcgccagcttcttggaagccggcggagacgagagctggctgagtggg
ctgcagaacgccccgccaaaactccgaggtctcaaccccctcaacaaactgctggcccac
agaccctggctcatcacacagctgcacatccaggagcttgtctatccgggcgccgagctg
cgctggtcactggccgagctgatccacgccgtcatcctgatgacgcacgcccacgcgctc
tgctccttcgtgtggggctgcggcctcaaccccgagccggatcacgcgggcggccacacc
ttccggccgccgtcgcccggccaccccacccgcagcccccaaagcccagcaaacgaggac
ggccggcaggagctggtggatggtgcagtggaagtggaagtgctgatgaagaggatggtt
gagctgcaggagcagcaggaggaagagtgtacgcaggaggagatggtcacacgctttgag
agggagcgaagcgagagtatccccaccgctttggtgcgaggcgcgccacccgagaggctc
cttcacctcatggaggacccggatttcagatacgaggactttgcacccagaggagagcag
gctccgcccaccatgagagcccaggactactcgtgggaggaccacggctactcgctggtc
aacaggctgctgccggacatgggacagctgcttgacgagaaatttcaggtggtgagcaac
atgacgtaccaccggatggccatgcacgagggtgtggacacgcacacgctgaggaaagcc
ctgtggaactacatccactgtctctacgggatacggtatgacgactacgactacggcagc
gtcaatgtgctgctggagcgctcccttaaagtgttcatcaagaccatggcctgccatccc
gagcagaccaccgggcacatctaccacgccttctggaggcacttcaggcactcagagaag
gtgcacgccaacctgatcgtgttggaggctcgcctgcaagcagcgctgttgtacacactg
cgagccatcactcactacatgagatga

KEGG   Hippocampus comes (tiger tail seahorse): 109516662
Entry
109516662         CDS       T04969                                 

Definition
(RefSeq) sestrin-3-like
  KO
K10141  sestrin 1/3
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109516662
SSDB
Motif
Pfam: PA26 CMD
Other DBs
NCBI-GeneID: 109516662
NCBI-ProteinID: XP_019726951
UniProt: A0A3Q2XE99
LinkDB
Position
Unknown
AA seq 445 aa
MIICTNKMEYPLRSQCQRVQKQAMVSKEKERASRVLMKSALGRGSVDAVSQQMASHPQYL
ESFLRAQHYILHMDGPLPLPCRHYIAIMAAARHHCNYLVYLHSAQFLRLGGDPLWLQGLE
AAPPRLRLLDHINKVLAHQPWLAACSHIKTLLKCGESCWSLAELVQAVVILAHCHSLCSF
VFGSNADSGHPAPPSKSPNGTPPTLCAFDAANGNPNGPLCLDNAAEQMTRRWSVDSSSDV
LCLKERIHRAQEERDKREERMLHAQTLQQADVEEDDEMMCFADPSRFVTDPDFDYQDFAR
RDEDHFQVFRVQDYSWEDHGFSLANRLYSDIGHLLDERFRSVTAVTSPHGPELKRAVWNY
IHCMLGIRYDDYDYGEVDRLLERDLKVYIKAVACFPDPSRSSARPLGWAPLKTSERIHVN
LLIMEARLQAELLYALRAITQYMVA
NT seq 1338 nt   +upstreamnt  +downstreamnt
atgatcatctgcacgaataaaatggagtatcctctcagaagccagtgccagagagtccag
aaacaggcgatggtgagcaaggaaaaggagcgcgcctctcgggtgctgatgaagtcggcg
ctaggccgcggcagcgtggacgccgtgtcgcagcagatggcgtcgcacccgcagtacctg
gagagcttcctgcgagcgcagcactacatcctgcacatggacggacctctgccgctgccc
tgtcgccattacatcgccatcatggcggcggcgcgccaccactgcaactatctggtctac
ctgcactcggcccagttcctgaggctgggcggtgaccccctgtggctgcagggcttggag
gcggcgcctccgcgtctgcgcctgctcgaccacatcaacaaagtgctggctcaccagccc
tggcttgccgcctgctcgcacatcaagacgcttctgaagtgcggcgagtcgtgctggtct
ctggccgagctagttcaggctgtggtgattctggcccactgccactcgctgtgcagcttc
gtatttggctccaacgccgattcgggccacccggcgcctccgagcaagtcccccaacggc
actccgcccaccttatgcgcctttgacgccgcgaacggcaaccccaacgggcctctgtgt
cttgacaacgccgccgagcaaatgacgcgaagatggtctgtggactcgagtagtgacgtg
ttgtgtctgaaagagaggatccacagagcccaggaggagcgagacaagcgagaagagcgg
atgctgcacgcccagacgctccagcaagccgatgttgaagaagacgacgaaatgatgtgc
ttcgcggacccgtcgcgctttgtcacagaccccgattttgattaccaggatttcgcccgc
agggacgaggaccacttccaagtatttcgagttcaggactactcgtgggaggaccacgga
ttctcgctggccaaccgcttgtactcggacatcggccacctcctggacgagcgctttcga
agcgtcaccgccgtgacgtcgccgcacgggcccgagttgaagagggccgtctggaactac
atccactgcatgttgggaattaggtacgacgattacgactacggggaagtggaccggctc
ctggagcgagatttgaaggtgtacatcaaggctgttgcgtgtttccctgaccccagcaga
agttcggcgcgtccactgggctgggctcctcttaaaacatcagagaggatccatgtgaat
ttactcatcatggaggcgcgtctgcaggcggagctcctctacgccctgagagccatcact
cagtacatggtcgcctga

KEGG   Hippocampus comes (tiger tail seahorse): 109530993
Entry
109530993         CDS       T04969                                 

Gene name
sesn1
Definition
(RefSeq) sestrin-1 isoform X1
  KO
K10141  sestrin 1/3
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109530993 (sesn1)
SSDB
Motif
Pfam: PA26 CMD
Other DBs
NCBI-GeneID: 109530993
NCBI-ProteinID: XP_019750553
UniProt: A0A3Q2Y1G5
LinkDB
Position
Unknown
AA seq 486 aa
MRHAVSPSENVENCSFAVTHLFKICAHCERLGKKDLGVRIPRPLGNGPSRFIPEKEILQV
SKVDTRTQSIFEDAFAALGRLDNISLVMGFHPQYLESFLRTQHYLLQMDGPLSLHYRHYI
GIMAAARHQCSYLVNLHVNDFLQVGGDPKWLNGLDGAPRKLQQLGELNKILAHRPWLLTK
EHIEGLLKAEEHSWSLAELIHAVVLLTHYHSLASFTFGCGIMPEIHCDGGHTFRPPSVGH
YCVCDIANGNNHHDSPFGSQEVCGGEVEVLMERMKQLQECRDDEEASQEEMATRFEREKT
ESMLVVTAEDEEWVPSRDISRHFEDPSYGYKDFSRRGEHVPTFRVQDYSWEDHGYSLVNR
LYPDVGQMLDEKFQMAYNLTYNTMATHKDVDTSMLRRAIWNYIHCMFGIRYDDYDYGEIN
QLLDRSFKIYIKTMVCSPEKTTKRMYESFWRQFQHSEKVHVNLLLMEARMQAELLYALRA
ITRYMT
NT seq 1461 nt   +upstreamnt  +downstreamnt
atgaggcacgccgtgtcaccgtcggagaacgtggagaattgttcgttcgctgtgacacac
ttgtttaagatatgtgcccattgtgaacggctcggaaaaaaggatctgggagtgcgaatc
ccaagacccctgggaaacgggccaagcagatttatccctgaaaaagagattcttcaagtc
agtaaagtggacaccaggacacagtcgatctttgaggatgcgttcgccgccctcggtcgc
ctggacaacatctcattggtgatgggcttccacccgcagtacctggagagcttcctgcgc
acgcagcactacctgctgcaaatggacgggccgctgtcgctgcactaccgccactacatc
ggcatcatggcggcggctcgccaccagtgctcctatctggtcaacctgcacgtcaatgac
ttcctccaggtgggcggcgaccccaagtggctcaacgggctggacggagccccaagaaag
cttcagcaactgggcgagctcaataaaatcctggcccaccggccgtggctgctcaccaag
gagcacatcgagggtttgctaaaagccgaggagcacagctggtcactggccgagctcatc
cacgctgtcgttctgctcacgcactaccactcgctggcctccttcaccttcggctgcggc
atcatgcccgagatccactgcgacggcggtcacaccttccggccgccctcggtcggccat
tactgcgtgtgcgacatcgccaatggcaacaaccaccacgacagtccctttggcagccag
gaggtgtgcggcggcgaggtggaggtgctaatggagcgcatgaagcagctgcaagagtgc
cgcgatgacgaagaggccagccaggaggagatggccacgcgcttcgagcgagagaagaca
gagagcatgctggtggtgacggccgaggacgaggagtgggtgccctcccgcgacatctcg
cgacacttcgaggaccccagctacggttacaaggacttctccaggaggggcgagcacgtg
cccactttcagagtgcaggactacagttgggaggaccacggctactccctggtgaaccgt
ctttatcccgatgtgggtcagatgctggatgagaagttccagatggcgtacaacctgacg
tacaacaccatggccacgcacaaggacgtggacaccagcatgctgcgcagggccatctgg
aactacatacactgcatgttcggcatcaggtatgacgactatgattatggtgagatcaac
cagctgttggaccgtagcttcaagatctacatcaagactatggtgtgcagcccagagaaa
accaccaagcgaatgtacgagagcttctggaggcagttccagcactctgagaaggtccat
gtcaatctgcttcttatggaagcgcgaatgcaagccgaacttttatacgctctgagagcc
atcactcgctacatgacatga

DBGET integrated database retrieval system