KEGG   Hippocampus comes (tiger tail seahorse): 109510030
Entry
109510030         CDS       T04969                                 

Gene name
perp
Definition
(RefSeq) p53 apoptosis effector related to PMP-22 isoform X1
  KO
K10136  TP53 apoptosis effector
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109510030 (perp)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_3 Claudin_2 Amastin Chromo
Other DBs
NCBI-GeneID: 109510030
NCBI-ProteinID: XP_019715567
LinkDB
Position
Unknown
AA seq 185 aa
MFRCGIAYPRCRWIVPLLLLFAIIFDIIAIAATSGWVTDEEGKTHYASMWEQYHGRNDQW
ESKSLMEFSWAQAVAALMILGLLILIGAFILSCVALCCTLNVTLLPVIGVMLIVVVVLQV
IALIIYPVKFNEQIFEGHYYYTWAYGFGWGATLLCIGCAVLFCCLPRYEDELTGLAKTKY
LYTSA
NT seq 558 nt   +upstreamnt  +downstreamnt
atgttccgctgcgggatcgcctacccacgctgcaggtggatcgtgcccctgctgctgctc
ttcgccatcatcttcgacatcatcgccatcgccgccacgtcgggctgggtgacggacgag
gagggcaagacgcactacgccagcatgtgggagcagtaccacggacgcaacgaccagtgg
gagagcaagtccctgatggagttctcgtgggcgcaggcggtggccgccctgatgatcctc
ggcctcctcatcctcatcggcgccttcatcctgtcctgcgtggcgctgtgctgcacgctc
aacgtcacgctgctgcccgtcatcggagtcatgcttattgtcgtcgtggtgctgcaggtg
atcgccctgatcatctacccggtcaagttcaacgagcagatcttcgagggccactactac
tacacgtgggcgtacggcttcggctggggcgccaccctgctgtgcatcggctgcgccgtg
ctcttctgctgcctgccgcgctacgaggacgagctcaccggcctggcgaagaccaagtac
ctctacacgtccgcctaa

DBGET integrated database retrieval system