KEGG   Hippocampus comes (tiger tail seahorse): 109510161
Entry
109510161         CDS       T04969                                 

Definition
(RefSeq) cytochrome c
  KO
K08738  cytochrome c
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04115  p53 signaling pathway
hcq04210  Apoptosis
hcq05132  Salmonella infection
hcq05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109510161
   04115 p53 signaling pathway
    109510161
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109510161
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109510161
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 109510161
NCBI-ProteinID: XP_019715850
UniProt: A0A3Q2YEQ3
LinkDB
Position
Unknown
AA seq 104 aa
MGDVAKGKKAFVQKCAQCHTVEEGGKHKVGPNLWGLFGRKTGQAEGYSYTDANKSKGIVW
GEDTLMVYLENPKKYIPGTKMIFAGIKKKGERQDLIAYLKSATS
NT seq 315 nt   +upstreamnt  +downstreamnt
atgggcgacgtggcgaaaggcaagaaggcgtttgtgcagaagtgcgcacagtgccacacc
gttgaggaggggggcaagcacaaggtggggcccaacctgtggggtctgttcggccgcaag
acgggccaggcggagggatactcgtacactgacgccaacaagagcaaaggaatcgtgtgg
ggtgaggacacgttgatggtttacctggagaaccccaagaagtacatcccaggcaccaag
atgatcttcgccggcatcaagaagaagggcgagcgccaggacctgattgcttacctcaaa
tcggcgacatcatga

KEGG   Hippocampus comes (tiger tail seahorse): 109522106
Entry
109522106         CDS       T04969                                 

Definition
(RefSeq) cytochrome c iso-1/iso-2-like
  KO
K08738  cytochrome c
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04115  p53 signaling pathway
hcq04210  Apoptosis
hcq05132  Salmonella infection
hcq05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109522106
   04115 p53 signaling pathway
    109522106
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109522106
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109522106
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 109522106
NCBI-ProteinID: XP_019735961
UniProt: A0A3Q2Z2R0
LinkDB
Position
Unknown
AA seq 106 aa
MGDAAKGKKVFVLKCAQCHTVEEGGKHKVGPNLWGLFGRKTGQAPGFSYTQANIDKGIIW
SEETLMVYLENPKKYIPGTKMIFSGLRKKKERQDIIAYLKDATSPK
NT seq 321 nt   +upstreamnt  +downstreamnt
atgggggacgcggcaaaagggaagaaggtgtttgtattgaaatgtgcccagtgtcatact
gtggaggaaggaggaaaacacaaagtggggccgaatctgtggggtctgtttggtaggaag
acaggacaagcgcccgggttttcttatacacaggcaaatattgacaaagggattatatgg
agtgaagagactctgatggtctaccttgaaaacccaaagaaatatattcccggaaccaag
atgattttcagcggtctgagaaagaaaaaagaaaggcaggatatcattgcatatttaaag
gatgccacttcacccaaatag

KEGG   Hippocampus comes (tiger tail seahorse): 109531259
Entry
109531259         CDS       T04969                                 

Definition
(RefSeq) cytochrome c-like
  KO
K08738  cytochrome c
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04115  p53 signaling pathway
hcq04210  Apoptosis
hcq05132  Salmonella infection
hcq05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109531259
   04115 p53 signaling pathway
    109531259
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109531259
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109531259
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 CCP_MauG
Other DBs
NCBI-GeneID: 109531259
NCBI-ProteinID: XP_019751021
UniProt: A0A3Q3DT26
LinkDB
Position
Unknown
AA seq 105 aa
MPGDINKGKKSFVQKCAQCHTVENGGKHKVGPNLWGLFGRKTGQAEGYSYTDANKSKGII
WDEDTLNVYLENPKKYIPGTKMIFAGIKKKNERADLIEYLKSVTS
NT seq 318 nt   +upstreamnt  +downstreamnt
atgcctggagacatcaataaagggaagaagtcctttgttcagaagtgcgctcagtgtcac
acagtcgagaatggtgggaagcacaaggttggcccaaacctgtggggtctgtttggtcgc
aaaacgggccaagcagaaggttacagctatacagacgccaacaaaagcaaaggcattatc
tgggatgaggacaccctgaacgtctatttggagaaccccaaaaagtacattcccggaaca
aagatgatctttgctggcatcaagaagaagaatgagcgcgccgaccttatagaatatctt
aaatctgtgacttcttaa

DBGET integrated database retrieval system