KEGG   Hippocampus comes (tiger tail seahorse): 109510270Help
Entry
109510270         CDS       T04969                                 

Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase E-like
  KO
K05620  transglutaminase 3 [EC:2.3.2.13]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    109510270
Enzymes [BR:hcq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     109510270
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_N Transglut_core Transglut_C
Motif
Other DBs
NCBI-GeneID: 109510270
NCBI-ProteinID: XP_019716012
LinkDB All DBs
Position
Unknown
AA seq 693 aa AA seqDB search
MSLLFNNSVFTGVDVHAKRNHDEHHTSELPEDQLTVRRGQAFKVTLDLAKPFKQGIDSLV
LIASTGGKRSLARSLACPTCRSISDLDFGSSANSLPVLVTPPADAPIGRYALKATLWGED
KTVATLVLLYNPWFSGDSVFLADEQERREYVLNEQGVIYRGSSNYISPLNWDFGQFEDDM
VDICLNILDKSLNYRKNPAGDLASRGDPVYVGRVISAMINSPDDRGVVMGNWSDSFEGGL
SPSHWSGSHDILSMWKNNNFRTVKYGQCWVFAGVMCSVMRLLGIPTRVVSNFVSAHDTDA
SLTIDVYHADEGARRKESNDSIWNYHVWVESWMKRPDLKANGKYDGWQVLDATPQEASDG
LYQCGPSSLVAIFNGETQLPYDVPFVFAEVNADCVDWLTKADGTDVKMSSDTKRVGKSVS
TKAVGYNKRLDITRTYKHREGSEEERAVFRYAISDDKDSVPDVGAPQPPTPPTPPRPLPQ
LIIQLVETSVPEYGKDVQMKLVMSSDSRVERKLNIRITVEGMHYNGTFVATIQSQVKEGT
LHPFRELTIPIVIPVRSYLKHMMYADSLKVSAVVTDKKHPDKKYLAEDDVVLHDPPVIVT
VNGFVRQHQVAYGEVIFMNPLQETLTGMTLTVSGSGLLRQELEHRLPNLSPNNRFRVQFP
FVPYRTGLKMLTADIHSSIFKDFKGSYAVNVRP
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atgagtttgctgttcaacaattcggtgttcacgggcgtggacgtgcacgccaagcgcaac
cacgacgagcatcacaccagcgagcttcccgaagatcagctgaccgtccgcaggggacag
gccttcaaggtcaccttggacttggccaagcctttcaagcagggcatcgattccctcgtc
ctcatcgcctccaccgggggtaagcgctcgctcgctcgctcgctcgcttgtccgacttgc
cgatccatttctgatcttgactttggctcgtcggccaacagcttgccggtgctcgtgacg
ccccccgcggacgcccccatcggcaggtacgctttgaaggccaccctgtggggggaggac
aagacggtggccacgctggtgctgctctacaacccctggttctccggagactcggtgttc
ttggcggatgagcaggagagacgagaatatgtgctgaatgaacaaggagtcatctacaga
ggaagttcaaattacatttcacctctcaactgggactttggacagtttgaagacgacatg
gttgatatttgcctcaacatcctggacaagagtctgaactacagaaagaaccccgccggc
gatctggcctcccgcggcgacccggtctacgtgggccgcgtgatcagcgccatgatcaac
agtccggacgacagaggtgtcgtgatgggcaactggtcggattccttcgagggcggcctg
tcgccgtcccactggagcggcagccacgacatcctctccatgtggaagaacaacaacttc
cggacggtcaagtacggccagtgctgggtctttgccggcgtcatgtgttcagtcatgcgt
ctgctgggcattcccacccgcgtggtctcgaacttcgtgtcggcccacgacacggacgcc
agcctcaccatcgacgtctaccacgccgatgagggggccaggcgcaaagagtccaacgac
agtatctggaactaccacgtgtgggttgagtcgtggatgaagcgtcccgacctgaaggcc
aacggcaaatatgacggctggcaggttctggatgctacgccgcaggaggccagcgacggc
ttgtaccagtgcggcccctcctctttggtggccatctttaacggcgagacccagcttccg
tacgacgtccccttcgtcttcgctgaggtcaacgcagactgcgtcgactggctgaccaaa
gccgacggcaccgacgtgaagatgtcctcggacaccaagcgagtcggaaagagcgtctcc
accaaggctgtgggctacaacaagcgcctggacatcaccaggacctacaagcacagggag
ggctcggaagaggagcgggccgtgttcaggtacgccatcagcgatgacaaagacagcgtg
cccgacgtaggcgccccgcaaccccccacgccgccaaccccgccgcgcccgctgccgcag
ctcatcatacaacttgttgagacgtcggtaccagagtacgggaaggacgtgcagatgaag
ctggtgatgagcagcgacagcagagtggaaaggaagctcaacatccgcatcaccgtggaa
gggatgcactacaacggcaccttcgtcgccaccatccagtcccaagtcaaggaggggacg
ctgcaccctttccgagagctgacaatacccattgtgatccccgtgcgttcgtacctcaag
cacatgatgtacgccgacagcttgaaggtgtcggccgtggtgacggacaagaagcatccc
gacaaaaagtacctggcggaggacgacgtggtactgcatgaccctcccgtcatagtcact
gttaacggttttgtgcggcagcaccaggtggcgtacggagaggtgatcttcatgaacccc
ctgcaggagaccctaacgggcatgacgctgaccgtgtcgggaagcggactcttgcggcag
gagttggaacacagacttcccaacttgtctcccaacaaccgcttccgcgtccagtttccg
tttgtcccgtacaggacaggcctcaagatgctgacggctgacatccattcatccattttt
aaagatttcaagggcagctatgcagtcaatgtcaggccatga

DBGET integrated database retrieval system