KEGG   Hippocampus comes (tiger tail seahorse): 109510641
Entry
109510641         CDS       T04969                                 

Gene name
rassf1
Definition
(RefSeq) ras association domain-containing protein 1 isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
hcq  Hippocampus comes (tiger tail seahorse)
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1 Ras_bdg_2
Other DBs
NCBI-GeneID: 109510641
NCBI-ProteinID: XP_019716669
LinkDB
Position
Unknown
AA seq 395 aa
MFFKHSAYLSHLTDDHGGVEVVSDTTSMGEFIELRDLTPGGEQVQLTSACSPRSPPRLER
ANALRISPGKVPDLLSRAGIIRVLSSCDLDQSLAEETGEGHDFQPCSHAQPTWCDLCGDF
IWGLYKQSLRCANCKFTCHYRCRPLIRLDCSWDRGSSTDYTLVVEHTIETDTNVDEPTEC
GKQVLTTADTQKKVKEYNTQINSNLFMNMNKDGSYTGFIKVQFKLARPVSVMHPKKAGCG
GAQNAGSRKGGGVKRRTSFYLPKDASKHLHISSRTSAREVIEALLKKFTVVDNPGKFALF
ERSERHEQVYIRKLSDNERPLPLRLCAGPNEKVLSFVLKENETGEVNWDAFTTPELKNFL
LILQREEEDHIKQIMERYKVARAKMQEALRGSTPG
NT seq 1188 nt   +upstreamnt  +downstreamnt
atgtttttcaaacatagcgcgtatctttctcatcttactgatgaccatggaggtgtagag
gtcgtgagtgacacaacgtccatgggggagttcatcgagctgcgtgacctaacgcctggc
ggagagcaggtccagctgactagcgcatgctcgcctcgctccccgccacgtttggagaga
gccaacgccctgaggatcagcccggggaaggtgccagatctgctgagcagggcgggcatc
atccgcgtcctgagcagttgcgaccttgaccagagcctggcagaagagaccggggagggc
cacgacttccagccctgcagccatgctcagcccacgtggtgcgacctgtgtggggacttc
atctggggcctctacaaacagagcttgcgttgtgccaattgcaagttcacatgccactac
cgctgtcgacccctgatccgcttagactgcagctgggatcgaggttcttccactgactac
acgttggttgtggagcacacaatcgaaacagacaccaatgtggatgaaccaaccgaatgt
ggaaagcaggtgttgacaactgccgatactcagaagaaggtcaaggagtacaacactcag
atcaatagcaatctgttcatgaacatgaacaaggacggttcctacaccggcttcatcaaa
gttcagttcaagctggcgcggcccgtgtcggtcatgcacccgaagaaagcaggatgcgga
ggtgcgcagaacgccggctccaggaagggcggcggtgtgaagcggcgcacctccttctac
ctgcccaaagacgcgtccaagcacctgcacatcagctcccgcacgtctgctcgcgaagtc
atcgaggccctgttgaaaaagttcaccgtggtcgacaaccctggcaagttcgcgctgttt
gagcgcagcgagcgccacgaacaagtttacattcgcaagctgtcagacaacgagcgcccc
ctacctctgcgactgtgtgctggacccaatgagaaagtgctcagttttgttttgaaggag
aatgagaccggagaagtcaattgggatgctttcaccacaccggaattgaagaatttcctg
ctcatcctccagcgcgaggaagaggaccacatcaagcagatcatggagcgctacaaagta
gctcgagccaagatgcaggaggctttacgcggctccacgccgggatga

DBGET integrated database retrieval system