KEGG   Hippocampus comes (tiger tail seahorse): 109510896Help
Entry
109510896         CDS       T04969                                 

Definition
(RefSeq) putative polypeptide N-acetylgalactosaminyltransferase-like protein 3 isoform X1
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq00512  Mucin type O-glycan biosynthesis
hcq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    109510896
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hcq01003]
    109510896
Enzymes [BR:hcq01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     109510896
Glycosyltransferases [BR:hcq01003]
 O-Glycan biosynthesis
  Mucin-type
   109510896
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3 RicinB_lectin_2
Motif
Other DBs
NCBI-GeneID: 109510896
NCBI-ProteinID: XP_019717129
LinkDB All DBs
Position
Unknown
AA seq 608 aa AA seqDB search
MAVLRRWRLLLVLNVLAVAGIMTLWSRCSSARKPTVRVDAPEGWDAADAERRRPGRANGT
ATVSHQVLLDRLSSLEDVVYRQLNGLSKSLGLIEGFGGWGAGGLAASLSPGEVSEAKYLR
DKYGYNAYLSNTISLDRTIPDYRPGSCRNVSHLRDLPQMALVFIFVNEALSVILRSVHSA
VNHTPAHLLKEIILVDDHSDDEQLKGPLEDYVKRRYPGLVKIVRNHKREGLIRARIEGWK
AASAEVTGFFDAHVEFTPFWAEPVLARIKEDRRRIILPSIDNIKHDTFEVERYENSGHGY
SWELWCMYINPPKQWWDDGDVTAPIRSPAMIGCSFVANRLFFGELGLLDPGMDVYGGENI
ELGIRVWMCGGSMEVLPCSRVAHIARVKKPYNSNIAFYMRRNALRVAEVWMDHFKSNVYL
AWNIPMENHGIDFGDISERVALRKSLQCKNFQWYLDNVYPEMRTYGNTLYYGEMRNSKAS
HLCLDQGMRENHTATLHPCHGWGPQIGRYTKEGHLYLGPLGSTGEDTRCVADDPATQFPQ
LLDCDKDKDEHRTKWIFTQGDSMINSASGRCLEVVPAKVYLGHQVVLQSCSGQRWTIKNT
MKDIAVYV
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atggctgtactgagaagatggaggcttctgctggtgctcaacgtgctcgcggtggccggc
atcatgacgctgtggagccgctgtagcagcgcgcgcaagccaacggtccgcgtggacgct
ccggagggttgggacgctgcggacgccgagcgcaggaggccaggccgggccaacggaacc
gccaccgtcagccaccaagtgctactcgacaggctcagctcgttggaggacgtcgtgtac
cgacagttgaacggtctgtccaaatctttgggccttatcgagggtttcgggggctgggga
gccggtggcctggccgccagcctttctccgggtgaggtgagcgaggccaagtacttgagg
gacaaatacggctacaacgcctacctgagcaacaccatctctctggaccgaaccatacca
gactacagacccggcagttgcagaaatgtcagccacctacgagatctcccccagatggcc
ttggtcttcatcttcgtcaacgaggccctgtccgtcatcctacgctcggtccactcggct
gtcaatcacacgccggcccacctgctcaaagaaataatcctggtggatgaccacagcgac
gacgagcagctgaaaggacctcttgaggactacgtgaagaggcggtaccccggtctggtc
aagatcgtcaggaaccacaagagggagggtctgatccgggccaggatcgagggctggaag
gcggccagtgctgaggtgacgggattttttgatgcccacgtggagttcacacccttctgg
gctgagccggtattggcccgaatcaaggaggaccgcaggaggattatactgccgtccatc
gacaacatcaagcatgacaccttcgaggtcgagcgttacgagaattcaggtcacggctac
agctgggagctgtggtgcatgtacatcaacccaccaaaacagtggtgggacgatggcgac
gtgacggcgccgatcaggagtcccgccatgattggctgctccttcgtggccaatcgtctc
ttctttggcgaactcgggctgctggaccctggcatggacgtctacggcggggagaacatc
gaactgggcatcagggtgtggatgtgcggaggcagcatggaggtgctgccgtgctcccgc
gtggctcacatcgcccgcgtgaagaagccctacaacagcaacatcgctttctacatgcgc
cgcaatgccctgcgtgtggctgaggtctggatggaccacttcaagtccaacgtctacctg
gcctggaatatccccatggagaatcacggcatcgactttggtgacatctctgagagggtg
gcgctcaggaagagtctgcagtgtaagaatttccagtggtacctggacaacgtttaccct
gagatgaggacgtatggcaacacactctactatggtgagatgcgcaactcgaaagcaagc
cacctgtgtttggaccagggtatgagggagaaccacacggccaccctgcacccatgccat
gggtggggtccccagataggacgttacaccaaagagggtcatctgtacctgggcccactg
ggcagcaccggggaggacactcgctgtgtggcggacgatcctgccacccaattcccgcaa
ctcctggattgcgacaaagacaaggacgaacaccgcaccaagtggattttcactcagggt
gattccatgataaactcggcctcgggccgctgcttggaggtggtgcccgccaaagtgtac
ttgggccaccaggtggtgctgcagtcctgctccggacagcggtggaccataaagaacacc
atgaaggatattgcagtgtatgtttag

DBGET integrated database retrieval system