KEGG   Hippocampus comes (tiger tail seahorse): 109511032Help
Entry
109511032         CDS       T04969                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like isoform X1
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq00052  Galactose metabolism
hcq00500  Starch and sucrose metabolism
hcq01100  Metabolic pathways
hcq04142  Lysosome
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    109511032
   00500 Starch and sucrose metabolism
    109511032
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    109511032
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hcq04147]
    109511032
Enzymes [BR:hcq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     109511032
Exosome [BR:hcq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109511032
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 109511032
NCBI-ProteinID: XP_019717319
LinkDB All DBs
Position
Unknown
AA seq 1010 aa AA seqDB search
MRHENKQTLTASALCKHTFASQFSRSKTWLNWCACLHLICSLIFRVPRGAVMVSYKLLNP
EDVQLSEVNHLVEEEENPVLHAEGASLLPRRVPCSATTGLLVTGCLLLLLCGGWLLGTMF
WLHRPSSLLPHRPPPPAQATSKANATEANSLFREACALIPEPWRFDCFPERGVVVTREMC
EARNCCFIPAAQPSGSNGVPWCFYSPEFPSYSVESVSDTSLGQKATLVKDVKGYYPADIL
TLELDVRYETDTRLRVRITDPSSSRYEVPIPVPTVSKKAESPDYSVELSKEPFGLVVRRI
STGAVLLNTTVAPLLYADQFLQFSTSLPTEFIYGLGEHRSSFLHDVQWNTLTLWARDVPP
VQEKTNLYGVHPFYLAMEKESNAHGFFLLNSNAMDVVLQPPPALTWRTIGGILDFYVFLG
PDPGSVIEQYLDVVGRPAMPIYWALGYHLCRWGFNSSNSTWDVVRRMRSNGIPQDVQWND
IDYMDRILDFTFDPTNFATLPNMVKDLHAHNQRYVMVIDAAISSVQPAGSYWPYDEGLRR
DVFIKDTEGKTLIGKVWPGLTAFPDFSDNVTHEWWYENLKKFHDQVPFDGLWIDMNEPSN
FVDGSTNGCPSNNLEHPPYTPGILGGLLRAKTVCASSLQKQSIHYNLHSLYGLMEGEASA
SALRRISAKRPFVIARSTFPGQGKYTGHWLGDNRSQWHDLYSSIAGILTFNLLGIPLVGA
DVCGFSEQPQEELCVRWTQLGAFYPFTRNHNAIDMKPQDPTAFSPLARTAMQQALLLRYS
LFPLLYTLFHHAHAQGHTVARPLVFEFPKDTKTYGIDKQFLWGRSLLVTPVLDPGVDFVE
GYFPEGLWYDYNTGDSLNSTGEEVRLSAPLDKINLHLREGSIIPTQTPNLTLWVSSGQPL
HLITALSNNGTACGDLFWDDGESLDTFETGQYAYIVFSVAQQTMSSRVLRNHLEASYITV
QSVSFYGVKEKPSKVLVNSRDATFAYRSNQVLSVADLGLNLSKNFTISWL
NT seq 3033 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcacgagaataaacagaccctcactgcgtcagcgttgtgcaaacacacttttgcc
tctcagttcagtcgttccaaaacgtggttgaactggtgcgcatgccttcacttaatttgc
tcattaatattcagagtcccacgcggtgccgtcatggtgtcgtataaactgttgaaccct
gaggatgtccagctatcagaagtcaatcaccttgtcgaggaggaggaaaatccagtgttg
cacgcagaaggagcctctctgcttccccgtcgtgtgccgtgctcggccacgacggggctc
ctggtgaccggctgtctgctgctgctcctctgcggaggctggctgctgggcaccatgttc
tggcttcaccgcccctctagcctgctgcctcatagaccaccgccgccggctcaggccacc
tcaaaagccaacgccaccgaggccaactccctcttccgcgaagcatgcgctctcatcccg
gagccgtggcgcttcgactgtttcccggagagaggagtggtggtgaccagagagatgtgt
gaagcgaggaactgttgcttcatccccgccgctcaaccttcgggaagtaacggtgtcccc
tggtgtttttattccccggagtttccctcctactccgtcgagtcagtgagtgacacaagc
ttggggcagaaggctacgcttgtcaaagacgtgaagggttactaccctgcagacattctg
actctggagttggatgtccgctacgagacggacacgaggctgcgggtcaggatcacagac
ccttcgagttcacgctacgaggttcccatacctgttcccaccgtcagcaagaaggcagaa
agtcccgactacagcgtggagctctccaaggagccgtttggtcttgttgtgaggaggatc
tctacaggagccgtcctcctgaacaccaccgtggctcctctcctttacgccgatcagttc
ctgcagttctccacctctctgcccaccgaattcatctacggcctgggggagcaccgctcg
agcttcctgcatgacgtccagtggaacacgctcaccttgtgggccagggatgtgcctccc
gtgcaggaaaaaaccaacctgtacggagttcatcctttttaccttgcaatggagaaggag
agcaatgcacatggcttcttccttctgaacagcaatgcaatggatgttgtcctgcaacct
cccccggccctcacctggcgcacaattggtgggatcctcgacttttacgtcttccttggt
cccgatcccggatctgtgatcgaacaatatctggacgtagtaggtcgtccagcgatgccc
atctactgggctttgggttaccatctgtgtcgctggggttttaactccagcaactccacc
tgggacgtggtccggcgcatgaggagtaatgggatacctcaggatgtccagtggaatgac
attgactacatggatcgaattctggacttcacttttgacccgactaactttgccacgctg
cccaacatggtgaaggacctgcacgctcacaaccaacgctacgtgatggtcattgatgct
gcaatcagtagcgttcagcctgcaggatcctactggccgtatgacgaaggactcaggaga
gacgttttcatcaaagacacagaaggaaaaacactcattgggaaggtgtggccaggcctg
actgcatttcccgatttctctgataacgtcacccacgaatggtggtacgagaatcttaag
aaattccatgatcaggtgccattcgatggattatggattgacatgaatgagccatcaaat
ttcgtagatgggtcaacgaatggctgcccgtcaaacaatctggagcatcctccatacact
ccaggcatactgggaggtttgctgcgcgccaaaacggtgtgcgcatcatcactgcagaag
cagtcgatacactacaaccttcatagcctgtacggactcatggaaggggaggcatctgca
agcgctctgaggaggatctcggccaagagaccttttgtgatcgctcgctccaccttcccc
ggtcagggcaagtacactggccactggctgggagacaacaggagccaatggcatgacctt
tactcctccatagcaggcatcctgacttttaacctcctgggcatcccgttggtgggagct
gacgtctgtggcttcagcgagcaaccgcaggaggagctgtgtgtccgctggacacagttg
ggcgctttctatccctttacccgcaaccacaacgccatcgacatgaagccacaagacccg
acggcgttcagcccgctggcccgcaccgccatgcagcaagctctgctgctgcgctattct
ctcttcccgctcctctacactctcttccatcacgcacacgcgcaggggcacactgtcgct
cgtccgctcgtctttgaattcccaaaggacacaaaaacgtacggtatcgataagcagttc
ctctgggggaggagcctactggtgactccggttttagatcctggggtggactttgtggag
ggctacttcccagagggtctttggtatgactacaacacgggcgactcgctaaacagcacg
ggggaagaggtgcgactctccgctcctctcgataagatcaacctgcacttgagggaagga
tctatcattccgacgcagacccccaacctgactttgtgggtgagcagcggccagcctctt
catctgatcaccgcgttgtcaaacaacggcaccgcctgtggcgatttgttttgggacgac
ggcgagagcctcgacacctttgagaccggccagtacgcctacatcgtcttcagcgtggct
cagcaaacgatgagctcgcgcgtgctccgcaaccacttggaggcctcgtacatcacagtg
cagtcggtgtctttctacggcgtgaaggagaagccaagcaaggtgctggtcaactccaga
gatgccaccttcgcctacaggagcaaccaggttttatctgtagccgatctcggccttaac
ctcagtaagaacttcaccatcagctggctgtga

DBGET integrated database retrieval system