KEGG   Hippocampus comes (tiger tail seahorse): 109511043
Entry
109511043         CDS       T04969                                 

Gene name
lpar2
Definition
(RefSeq) lysophosphatidic acid receptor 2
  KO
K04291  lysophosphatidic acid receptor 2
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04080  Neuroactive ligand-receptor interaction
hcq04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109511043 (lpar2)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109511043 (lpar2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hcq04030]
    109511043 (lpar2)
G protein-coupled receptors [BR:hcq04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    109511043 (lpar2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srv Ninjurin Claudin_2
Other DBs
NCBI-GeneID: 109511043
NCBI-ProteinID: XP_019717337
UniProt: A0A3Q2XES2
LinkDB
Position
Unknown
AA seq 370 aa
MDIQTDDTEGCYLNRSVKFFYEKSGKNISDHWSRRDYVIVSLGMTVCFIVIFSNLLVIGA
ILKNRRFHFPIYYLLGNLALADLFSGVSYLHLMFHTGPWTIKLSKYQWFVRQGLIDTSLT
ASVLNLLAVAVERHQTIFNMQLHSKMSTRRVFVIMIFIWLVAIVMGLVPTMGWHCLCDLD
KCSTMAPLYSRSYLVFWALLNLLTFSIMVAVYTRIFLYVRHKSKQMSQHTTQMRHRETVL
NLMKTVSMILGWFVICWTPGLVVLLLDGLGCDKCKVLRYEKYCLVLAECNSLVNPIIYSF
RDKDMRRTFREILCCLCQRGGDKSGVSGVNFNTLDHENSKSRDMELMEKSNGAPLISKHS
DEAPSPDSWN
NT seq 1113 nt   +upstreamnt  +downstreamnt
atggatattcagacagacgacaccgagggatgctacctgaaccgcagcgtcaaatttttc
tacgagaaaagcggcaagaacatcagcgaccactggagccgccgtgactacgtcatcgtc
tcgctggggatgaccgtctgcttcatcgtcattttctccaacctgcttgtcattggggcc
attttaaaaaaccgacgcttccatttccccatctattacttgttggggaacttggctctg
gcagacctcttctcaggtgtctcctacctccacttgatgttccacacgggcccgtggacg
atcaagctgtccaagtaccagtggttcgtgcgccaggggctgatcgacaccagcctgacc
gcatccgtcctcaacctgttagccgtggccgtggagcgccaccagaccatcttcaacatg
cagctccacagcaagatgagcacccggcgcgtttttgtcatcatgatcttcatctggctg
gtggccatcgtcatgggcctggtgcccaccatgggatggcactgcctgtgcgacctggac
aagtgctccaccatggcgccgctctacagccgcagctacctggtgttctgggcgctcctc
aacctgctgactttctccatcatggtggccgtctacactcgcatcttcttgtacgtgagg
cacaagagcaagcagatgtcgcagcacaccacgcagatgagacatcgggagacggtgctc
aacctgatgaagaccgtctccatgatcttaggctggtttgtgatctgctggactcccggc
ctggtggtgctgctgctggacggcctgggctgcgacaagtgcaaagtgctgcgctacgag
aagtactgcctggtactggccgagtgcaactccctggtcaaccccatcatctactccttc
cgggacaaggacatgcggaggaccttcagggagatcctgtgctgcctgtgccagcgcggc
ggcgacaagtcgggcgtgtccggcgtgaactttaacaccctggaccacgagaactccaag
tctcgcgacatggagctgatggagaagagcaacggggcgccgctcatcagcaaacactcg
gacgaggcgccatcgccggacagttggaattaa

DBGET integrated database retrieval system