KEGG   Hippocampus comes (tiger tail seahorse): 109511417
Entry
109511417         CDS       T04969                                 

Definition
(RefSeq) caspase-3-like
  KO
K02187  caspase 3 [EC:3.4.22.56]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04010  MAPK signaling pathway
hcq04115  p53 signaling pathway
hcq04210  Apoptosis
hcq05132  Salmonella infection
hcq05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109511417
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109511417
   04115 p53 signaling pathway
    109511417
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109511417
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109511417
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hcq01002]
    109511417
Enzymes [BR:hcq01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.56  caspase-3
     109511417
Peptidases and inhibitors [BR:hcq01002]
 Cysteine peptidases
  Family C14: caspase family
   109511417
SSDB
Motif
Pfam: Peptidase_C14
Other DBs
NCBI-GeneID: 109511417
NCBI-ProteinID: XP_019718062
UniProt: A0A3Q2XLV2
LinkDB
Position
Unknown
AA seq 278 aa
MSANGPAGVDCTDARKKGDGQASESSMDVDARKAAAHSYRYSLQFPSIGQCIIINNKNFD
RRTGMNPRNGTDVDAANAMKVFGKLGYRCKIYNDQTVTQMKQVLTTVSKEDHGGCASLVC
VLLSHGDEGVFFGTDGSIELKHLTSLFRGDRCKTLVGKPKLFFIQACRGTELDAGIETDS
ADDGAARIPVEADFLYAYSTAPGYYSWRNTMTGSWFVQSLCEMLSAHGHALELQHILTRV
NHKVALEFESVSTAPGFDAKKQIPCIVSMLTKEMYFVP
NT seq 837 nt   +upstreamnt  +downstreamnt
atgtcggctaacgggcccgctggagttgactgcacggacgcgagaaaaaaaggcgacgga
caagcgtccgagagctccatggacgtggatgcccgcaaggctgcggcacacagttacaga
tacagcctgcagttcccctccatcggacaatgtatcatcatcaacaacaagaatttcgac
aggaggacaggcatgaatccacgcaacggaaccgacgtggacgcggccaacgccatgaaa
gtgttcggcaagttgggttaccggtgcaaaatttacaatgaccagacagtgacgcaaatg
aaacaggttttaactacagtgtccaaggaggatcacggcggctgtgcgtcgctggtgtgc
gtgttgcttagtcacggcgacgaaggcgtcttcttcggcaccgacggttccatcgagctc
aaacacctcacctcgcttttccgcggggatcgctgcaagacgctggtgggcaagcccaaa
ctattcttcatacaggcatgcagaggcaccgagctggatgccggcatcgaaacggacagc
gccgacgacggcgccgccaggatccccgtcgaggcagacttcctctacgcctattccacc
gcgccaggctattactcgtggaggaacaccatgacgggctcttggtttgtccagtcgctt
tgcgagatgctgagcgcacacggccacgcgctggagctgcagcacatcctcacccgcgtc
aaccacaaggtggcgctggagtttgagtcggtctccaccgcgccgggcttcgacgccaag
aagcagatcccgtgcatcgtgtccatgctgaccaaggagatgtactttgtaccctga

KEGG   Hippocampus comes (tiger tail seahorse): 109515795
Entry
109515795         CDS       T04969                                 

Definition
(RefSeq) caspase-3-like
  KO
K02187  caspase 3 [EC:3.4.22.56]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04010  MAPK signaling pathway
hcq04115  p53 signaling pathway
hcq04210  Apoptosis
hcq05132  Salmonella infection
hcq05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109515795
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109515795
   04115 p53 signaling pathway
    109515795
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109515795
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109515795
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hcq01002]
    109515795
Enzymes [BR:hcq01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.56  caspase-3
     109515795
Peptidases and inhibitors [BR:hcq01002]
 Cysteine peptidases
  Family C14: caspase family
   109515795
SSDB
Motif
Pfam: Peptidase_C14 KNOX2
Other DBs
NCBI-GeneID: 109515795
NCBI-ProteinID: XP_019725374
UniProt: A0A3Q2YY34
LinkDB
Position
Unknown
AA seq 293 aa
MDATKDAHSVERSGDTLDAFNLFTKRKNPSNASKKDEETDSVPIKKADNPFQYKMDYPHM
GICLIINNKNFDRSTRMSTRNGTDVDAAFAMKTFSALGYKIKVATDQTVKQMKSLMLSVS
QEDHSSCASFVCVLLSHGEEGVIFGTDGYELLENLTKPFKGHRCSTLVGKPKLFFIQACR
GSELDEGTEIQADSVAEQTSERIPVEADFLYAYSTAPGYYSWRNTQNGSWFMQALCEMLQ
RFRGELELMQIMTRVNYKVAMHFESSSNVPGFTGKKQIPCIVSMLTKDLYFPQ
NT seq 882 nt   +upstreamnt  +downstreamnt
atggatgcaaccaaagatgctcattctgtagagaggtctggggacactttggacgccttc
aatctatttacaaagaggaagaatccatccaatgccagtaagaaagatgaggaaacagac
tctgtacccatcaaaaaagccgacaacccttttcagtacaagatggactacccacacatg
ggaatctgcctgattatcaacaataagaacttcgaccgcagtacaaggatgagcactcgt
aatgggacggatgttgatgctgcttttgccatgaagactttttcggctcttggttataag
atcaaagtggccactgatcagactgtaaagcaaatgaagagtctaatgttgagtgtatcc
caagaggaccatagcagctgtgcgtcatttgtgtgtgtgttgctaagtcatggtgaagaa
ggtgtgatttttggaactgatggatatgagttgcttgaaaacctgaccaaaccttttaaa
ggacatcgttgcagcactctggtgggaaaaccaaagctcttctttatccaggcatgccgc
ggctcagaactggatgagggaaccgaaatccaagccgacagcgtggcggagcaaacgtct
gagaggattcccgtcgaggccgacttcttgtatgcctattcgacagccccaggctattac
tcatggaggaacacgcaaaacggttcctggttcatgcaggcattatgtgagatgttgcaa
cgtttcagaggcgagttggaactgatgcagatcatgactcgggtcaactacaaggtggca
atgcactttgaatccagctccaatgttcctgggtttaccggcaagaagcagattccctgc
attgtctcaatgttaaccaaagacctttacttccctcaataa

DBGET integrated database retrieval system