KEGG   Hippocampus comes (tiger tail seahorse): 109511561
Entry
109511561         CDS       T04969                                 

Definition
(RefSeq) cyclin-G1-like
  KO
K10145  cyclin G1
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109511561
SSDB
Motif
Pfam: Cyclin_N
Other DBs
NCBI-GeneID: 109511561
NCBI-ProteinID: XP_019718275
UniProt: A0A3Q2ZDM6
LinkDB
Position
Unknown
AA seq 299 aa
MIDTVTGPGTLPFAVQLKALTDLEGRYQPKLSGLRIIESASDNGLRMTSRLRDLEVKDLL
TLSRFFGFSSETFSLAISLLDRFLSVMKIQPKHLSCVGLCCFYIAVKSSEENKNIPLAND
LIRISQNRFTVSDMMRMEKIIIEKLNWKVKAPTALRFLRLFHSYVQEQLGADSEKKLSLE
RLETQLKACHCSFVFSKMKPSLLAMALLRLEVEDQRDPEERDQLSEAMESLQKLLTIRDG
DLVCVRELVGKCLAEYSTAKCSRPNSQRLRWTISGRTARQLKHSYYKITHLPTIPESAC
NT seq 900 nt   +upstreamnt  +downstreamnt
atgattgacacagtgacaggacccggaacactgccttttgcagtccagctgaaggcctta
acagacctggagggccgctaccagccaaagctcagcggtctgaggatcattgagagcgct
tcggacaatgggctgaggatgacgagcagattgagggacctggaggtgaaggacttgctc
actctgagtaggttctttggtttcagctctgagacgttttctctggccatcagcctgctt
gaccgcttcctctcggtcatgaagattcaaccaaagcacctgtcctgcgtgggtctctgc
tgcttctacattgctgtgaagtcctcagaagagaataagaacatcccccttgccaacgac
ctgatccgcatcagtcagaaccgcttcacggtttctgacatgatgcggatggagaagatt
attatagaaaaactcaactggaaggtcaaggcccccacggccctccgcttccttcgcctc
tttcacagctacgtccaggagcaactcggtgcagacagcgagaagaaactgagccttgag
agactagagactcaattgaaagcttgtcactgctcctttgtcttctccaaaatgaagcca
tctctgcttgccatggctctcctgcgtcttgaggtggaggaccaacgtgacccagaggaa
agggaccaactctcagaggctatggaaagtctacagaagctactgactatcagagatggc
gatctcgtgtgtgtgcgtgagttggtgggcaaatgccttgctgaatactccactgctaag
tgctccaggccgaacagccagaggcttcgctggaccatttcgggaagaaccgctcgccag
ctgaagcacagctactacaagatcactcaccttcctaccatacccgagtcggcttgctaa

KEGG   Hippocampus comes (tiger tail seahorse): 109515756
Entry
109515756         CDS       T04969                                 

Gene name
ccng1
Definition
(RefSeq) cyclin-G1
  KO
K10145  cyclin G1
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109515756 (ccng1)
SSDB
Motif
Pfam: Cyclin_N
Other DBs
NCBI-GeneID: 109515756
NCBI-ProteinID: XP_019725307
UniProt: A0A3Q2ZDM6
LinkDB
Position
Unknown
AA seq 299 aa
MIDTVTGPGTLPFAVQLKALTDLEGRYQPKLSGLRIIESASDNGLRMTSRLRDLEVKDLL
TLSRFFGFSSETFSLAISLLDRFLSVMKIQPKHLSCVGLCCFYIAVKSSEENKNIPLAND
LIRISQNRFTVSDMMRMEKIIIEKLNWKVKAPTALRFLRLFHSYVQEQLGADSEKKLSLE
RLETQLKACHCSFVFSKMKPSLLAMALLRLEVEDQRDPEERDQLSEAMESLQKLLTIRDG
DLVCVRELVGKCLAEYSTAKCSRPNSQRLRWTISGRTARQLKHSYYKITHLPTIPESAC
NT seq 900 nt   +upstreamnt  +downstreamnt
atgattgacacagtgacaggacccggaacactgccttttgcagtccagctgaaggcctta
acagacctggagggccgctaccagccaaagctcagcggtctgaggatcattgagagcgct
tcggacaatgggctgaggatgacgagcagattgagggacctggaggtgaaggacttgctc
actctgagtaggttctttggtttcagctctgagacgttttctctggccatcagcctgctt
gaccgcttcctctcggtcatgaagattcaaccaaagcacctgtcctgcgtgggtctctgc
tgcttctacattgctgtgaagtcctcagaagagaataagaacatcccccttgccaacgac
ctgatccgcatcagtcagaaccgcttcacggtttctgacatgatgcggatggagaagatt
attatagaaaaactcaactggaaggtcaaggcccccacggccctccgcttccttcgcctc
tttcacagctacgtccaggagcaactcggtgcagacagcgagaagaaactgagccttgag
agactagagactcaattgaaagcttgtcactgctcctttgtcttctccaaaatgaagcca
tctctgcttgccatggctctcctgcgtcttgaggtggaggaccaacgtgacccagaggaa
agggaccaactctcagaggctatggaaagtctacagaagctactgactatcagagatggc
gatctcgtgtgtgtgcgtgagttggtgggcaaatgccttgctgaatactccactgctaag
tgctccaggccgaacagccagaggcttcgctggaccatttcgggaagaaccgctcgccag
ctgaagcacagctactacaagatcactcaccttcctaccatacccgagtcggcttgctaa

KEGG   Hippocampus comes (tiger tail seahorse): 109525202
Entry
109525202         CDS       T04969                                 

Definition
(RefSeq) cyclin-G2-like isoform X1
  KO
K10146  cyclin G2
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04068  FoxO signaling pathway
hcq04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    109525202
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109525202
SSDB
Motif
Pfam: Cyclin_N
Other DBs
NCBI-GeneID: 109525202
NCBI-ProteinID: XP_019741081
LinkDB
Position
Unknown
AA seq 329 aa
MFFSRMRDHGGLDKTLVKELKSCCAQEGNFLPSKSGLKMMESSESAVSAKCRDARVEELW
GLTSFFGYSTQTFVRAVNLFDRYLTLTKAQPKNVPRVSVCCLHLAAGATEAAKDVAPSQE
LIRISHTKFTASDLRRTETVVAQKLRPESPTVTAFTFLQLYHSALSAVCCDEGINIPSIV
KLEAHLKACLCRLVFSKAKSSVLALALVTHEFETLQCAATSKMLRQMQRLTKVGDSDLRQ
WRHLVATRMTEYHSARCHKPDGRKLVWVLSSRTVQSLNTSHCAAPRLPSIPEDACDHRLS
EEDVSSGEDSPCGSLGSVGEGSFFPDSDS
NT seq 990 nt   +upstreamnt  +downstreamnt
atgttcttttccaggatgagggaccatggaggactggacaagaccctggtgaaagagctg
aagtcctgctgtgcacaggagggcaacttccttcccagcaagtctggtttgaagatgatg
gagtcctctgaaagtgccgtgtcggccaaatgcagagacgccagagtggaggagctgtgg
ggtctgaccagcttcttcggctacagcactcaaacgtttgtccgagccgtcaatctgttc
gatcgatatctcacccttacaaaggctcagcccaaaaacgtgccgcgcgtgtccgtgtgc
tgcctccacttggcggccggcgccacggaggcggccaaagacgtggcacccagccaggag
ctcatccgcatcagtcacaccaagttcaccgcgtcggatctgcgtcgcaccgagaccgtc
gtggcccagaagctccgccccgagagccccacggtgaccgccttcacctttctgcaactc
taccactcggctttgagcgccgtgtgctgcgatgaggggataaacattccaagcatcgtg
aagctggaagctcatctgaaagcctgcttgtgtcgacttgttttctccaaagcaaaatcg
tccgtgctggccctcgccctcgtcacccacgagttcgaaaccctgcagtgcgccgccacg
tccaagatgctacggcagatgcaaagacttacaaaggtaggcgacagcgatctgcggcag
tggcggcaccttgtggctacgcgcatgacggagtaccactcggctcggtgccacaagccc
gacggcaggaagctggtgtgggtcttgtccagtaggacggtgcagagtctgaacacctcc
cactgcgccgccccccgtctgccctccattcccgaggacgcctgcgaccacagactaagt
gaggaggacgtgagtagcggcgaagacagtccgtgcggctctctgggcagtgtcggtgaa
gggtccttcttccctgactctgattcgtga

KEGG   Hippocampus comes (tiger tail seahorse): 109527070
Entry
109527070         CDS       T04969                                 

Definition
(RefSeq) cyclin-G2-like
  KO
K10146  cyclin G2
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04068  FoxO signaling pathway
hcq04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    109527070
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109527070
SSDB
Motif
Pfam: Cyclin_N FCD
Other DBs
NCBI-GeneID: 109527070
NCBI-ProteinID: XP_019744314
LinkDB
Position
Unknown
AA seq 331 aa
MDAFKLMKELRANYELEVYYLPKETGLSLIESTNQKDGRISAKCRDAKVEDLWSLTSFFG
YSTQTFVLAVNLLDRFLAMMRIQPKHLSCVSLSCLHMAAKMTEEECNLASTDELIRIGQC
RFSVSDLGRMEKIITEKLDFKSKSVTALTFLHLYHRIALSHSTHNQRWVMWETREAQLKA
CLCRISFSKAKPSVLALSLLRQQIEAIQSQDMLEIARHIQRHLKIADSELLLWRGQVAQC
LSDYASPECSKPNHRKLQWIVSRRTAQNLHSSYRSVPELPTIPECCWDESESEDSCEDMM
SSGEESLSSSLGSDGEGPFFPAHLRHQYLNA
NT seq 996 nt   +upstreamnt  +downstreamnt
atggatgccttcaaactgatgaaggaactgcgggccaactatgagctggaggtctattat
ctccccaaggagacaggcctgagtctcattgagtccactaatcagaaggacgggcggatc
tcagccaagtgcagagatgccaaagtggaggacttgtggagtctgaccagcttctttggc
tacagcacgcagaccttcgttctggctgtgaacctgcttgacagattcttggccatgatg
aggatccaaccgaagcacttgtcctgcgtcagcctgagctgcctccacatggccgccaaa
atgacggaggaggaatgcaacctcgcgtccacggacgagctcatccgcatcgggcagtgc
cgcttcagtgtgtccgacctcggccggatggagaagatcatcactgagaagctcgacttc
aagtccaaatctgtcacagccttgacctttctgcacttgtaccatcggattgcactatct
cactccacgcataatcagcggtgggtcatgtgggagacgcgggaggcgcagctcaaggcc
tgcctgtgccggatctccttctccaaagccaagccgtctgtcctggccttgtcgctcctg
aggcagcagatcgaagccattcagtcgcaggacatgttggaaatagcccgtcacatccag
agacacctgaagattgcagacagcgagctcctgttgtggcgcggccaagttgctcagtgc
ttgtcggactacgcctctccggagtgcagcaaacccaatcataggaaactgcagtggatc
gtgtcgcgtcggaccgcccagaacctacacagcagttaccgcagcgtacccgaactgccc
accatccccgagtgctgctgggatgagagcgagagtgaggactcctgcgaggacatgatg
agttcgggcgaggagtccctcagcagctcactgggcagcgatggcgaagggccctttttt
ccagctcacctccgccaccaatacctcaacgcctga

DBGET integrated database retrieval system