KEGG   Hippocampus comes (tiger tail seahorse): 109511699
Entry
109511699         CDS       T04969                                 

Gene name
casp9
Definition
(RefSeq) caspase-9
  KO
K04399  caspase 9 [EC:3.4.22.62]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04115  p53 signaling pathway
hcq04210  Apoptosis
hcq04370  VEGF signaling pathway
hcq05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    109511699 (casp9)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109511699 (casp9)
   04115 p53 signaling pathway
    109511699 (casp9)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109511699 (casp9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hcq01009]
    109511699 (casp9)
   01002 Peptidases and inhibitors [BR:hcq01002]
    109511699 (casp9)
Enzymes [BR:hcq01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.62  caspase-9
     109511699 (casp9)
Protein phosphatases and associated proteins [BR:hcq01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     109511699 (casp9)
Peptidases and inhibitors [BR:hcq01002]
 Cysteine peptidases
  Family C14: caspase family
   109511699 (casp9)
SSDB
Motif
Pfam: Peptidase_C14 CARD CARD_2 MM_CoA_mutase CKAP2_C
Other DBs
NCBI-GeneID: 109511699
NCBI-ProteinID: XP_019718500
LinkDB
Position
Unknown
AA seq 442 aa
MEDHHKKILQRYRINIVTSLDPSCLYDRLLQKGVFTQDMIEKIKSSGTRRDQARQLARDL
PTRGSRAFPLFLECLQASEQHTLAELLQSGAPAVQGSMSNRLIHPVVRTLPVSSTVDFQT
QVKAPPVHPIQTPAPPDSENLQAQMRVRTRMQGRTRRDSLQSYKMDASPCGHCLIINNVD
FEPQSELSNRTGSNIDCDRLERRFKALRFLVEVRTNLKHRRIKHELSDLSKKDHSPYDCC
VVIILSHGTEVSHNRFPGAVYGVDGRYVPVQHITNYLNGKHCPSLQGKPKLFFIQACGGG
ERDRGFEVPSDEAEPSSGGADDQTDAIPASSSSDSLSTSDEPDAGATLPTPSDILVSYST
FPGYVSWRDPQSGSWYIETLDRILEENAATEDLVTMLMMVNNEVSQNSAKGIYKQMPGSF
NFLRKHLYFQTSTLGQNSSEQM
NT seq 1329 nt   +upstreamnt  +downstreamnt
atggaggaccatcacaagaagattcttcagcgctacaggataaatattgtcacgagtttg
gacccatcatgtctctatgaccgcctgcttcagaaaggggtttttactcaagacatgatc
gagaaaataaagagctcaggaacaagacgggaccaagccaggcaactggcgcgggacctg
ccgacccgtgggagtcgggcctttcctctatttctggaatgtcttcaggcttcagagcag
cacactttggcagagctcctccaaagtggagcacctgcggttcaggggtcaatgtccaac
cgcctcattcaccctgttgtccggactcttccagtttcctctacagtggatttccagacg
caagtaaaggctccccctgtacatccaatacagactcccgcaccacctgattcggagaac
ctacaagctcagatgcgagtcagaacgcgcatgcaaggcaggacacggcgggacagcctt
cagagctacaaaatggacgccagcccgtgcggacactgcctcataatcaacaatgtggat
tttgagccacagagcgagctaagtaaccgcacggggtccaacatcgactgcgacaggctg
gagaggcgattcaaagctctccgctttctcgtcgaagtgaggacaaacctcaaacaccga
cggatcaaacacgagttgtcggatttatcgaagaaggaccattcgccctacgactgctgc
gtggtcatcattctgtctcatgggacggaggtgagtcacaaccgcttccccggtgctgtt
tatggggtcgacggccggtatgttcctgtgcagcacatcacaaactacctcaacgggaag
cactgtccctccctgcaggggaaaccaaagcttttcttcatccaggcctgcggaggaggt
gaaagagacagaggcttcgaggtgccgtccgacgaggcggaaccgtcgagtggcggagcc
gatgaccagacagacgccatccccgcgtcctccagcagcgactcgctgagcacgtctgat
gaacctgacgccggcgccacactgcccaccccgagtgacattctcgtgtcctactcaact
tttccaggttacgtgtcttggagggacccacagtcgggttcctggtacattgaaacgctg
gaccgcattcttgaggaaaatgctgccactgaggatttggtcacaatgttaatgatggtt
aacaatgaagtctcccagaactctgcaaaaggcatatataagcaaatgccaggttccttt
aacttccttcggaaacatctgtactttcaaacctcaacgctgggacaaaattcatctgaa
caaatgtaa

DBGET integrated database retrieval system