KEGG   Hippocampus comes (tiger tail seahorse): 109512895
Entry
109512895         CDS       T04969                                 

Gene name
atm
Definition
(RefSeq) serine-protein kinase ATM
  KO
K04728  serine-protein kinase ATM [EC:2.7.11.1]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq03440  Homologous recombination
hcq04068  FoxO signaling pathway
hcq04110  Cell cycle
hcq04115  p53 signaling pathway
hcq04210  Apoptosis
hcq04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    109512895 (atm)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    109512895 (atm)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109512895 (atm)
   04210 Apoptosis
    109512895 (atm)
   04115 p53 signaling pathway
    109512895 (atm)
   04218 Cellular senescence
    109512895 (atm)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hcq01001]
    109512895 (atm)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hcq03032]
    109512895 (atm)
   03400 DNA repair and recombination proteins [BR:hcq03400]
    109512895 (atm)
Enzymes [BR:hcq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109512895 (atm)
Protein kinases [BR:hcq01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   109512895 (atm)
DNA replication proteins [BR:hcq03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     109512895 (atm)
DNA repair and recombination proteins [BR:hcq03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    109512895 (atm)
SSDB
Motif
Pfam: PI3_PI4_kinase FAT TAN FATC
Other DBs
NCBI-GeneID: 109512895
NCBI-ProteinID: XP_019720538
LinkDB
Position
Unknown
AA seq 3083 aa
MSLALSDLLVCCRGLENDKVTERKKEAERFRKLIRSPEIVQELDRTSGPKTKGSKQLTWD
AVFRFLQRYLQRETETMKSSKSNVTTTTLAIRQKKMSEISSLIRFFVCYANKRGPRLKCS
ELLKHVIDVLQNSYSCSAFGKDYSNLLLREILSVRKYWCDITPQQWHSLLDVYSRLFTSS
STSINRVLVSRVINTVVRGCCMQTDGFNKTLFSFFAKALLNARHEKHLTVLEHVISALNT
FLKAVAMNCRMRVCRLGEELLPSILYVWANMRPSAALKEEIVEFFNLQLCIHHPKGAKTQ
DTGAHAEDWARWRDLLYNLYEALVKEISQIGSRGKYVTGTRHIAVKDNLIKLAADICHQL
FSTDEDSQISEATQASSLITSSLCGTPSKRRRIDLSWEVLLDRLQPHCSDFDIIPWLQIT
EALISNYPSMVPSQATVPLLSMLHQLLAEHRRGERGLYVLRCLREVARCQAHFPERIRVY
KPELDKLWSRVWPLTLRRVSSPQLEALSLDLLVSIVHGGLVNVDREFWKLFSGSACKPSQ
SAVIGLAQALLKCPVPKDHLGVPDGSGSLNLKETLIGWLLMTDQSDEMEDNSRPHPIICS
DFPHNLIANILVSLTVKDTCAGLNFLLGSEGVEGAFSQECTSLGVNEDLDKIERLYLQFS
FNTELAQSRGSDKKSKVTSANGHFTAIGGLKKKLEQSLLCVADNLLNCSFPNSQSTTPEC
LLRCLSLLTGVQAGYVSTGCLTEDEAERSQLFTKAKTLAQELSGFVSSVKVKMSEELTMT
TLRSVIRLCTITATTKNKENICTFSSRLFIMTLPASFITELAEIYKIMLSSVSPRASVVD
KDEPTDNDWEMTRTQHGDDHPLFDDEEFHSGTQRARGGDSNEMSSGPGAKSLLADEHLVH
QDLALLEILEFLCKCGSVQPVHGQLYKPQEVRRRLLLLVEQIDPSKALHVNMYLVLLKKL
PTEDSLTPEEFDSLLRPLADLCSLYRQDQEMCVALLVALLPSIRSLGRTHDMQLEMKHVQ
GSLLQVLSGFCYLSQTGKCTATVRVALVQCLVALLEADPCCRWAILSIREAEREEDRPVS
VILPSLLADPHHQVRMLVAMSLERLFLDMRPKHRDERKMLSDQQAAFENIYLKAQEGMTP
VKSSSTDDEQDEIFNRKATLLKSLSVVLCCSPVCEKQTLFALFQSYKENNIDEHLIKKML
CSVSRTLGYNKMKTFVSSHLYYLVAEWLSQRQSDDSYTLESFPFTLLDHGTLKDFYSSSY
QVLIPHLVFLDDFEQVKSIGRYLERDWRELLADCFPKIMVNILPYFALSGQETAQQREKA
HRVYDLLKDANCLGKQQIDSLIHSNLPELVVELLMTLYERGASEEDRGDLKRFIGELDPV
PNPPYFSSQVIKATLDYLSKCHSSNHKSLVAILSKTPISIQRILLAICEKAAVTTNGYER
HRILLMYHLFVNLLLREVKDSLGGAWAFVLRDIIYTLIHHINSWLVHADTQRPIQCDEVS
KRSLSLCCDLLTAVCQAALQFCDDALDCHLKVIVGTLTAQVTSQPAISQQVLSLLKFLVI
KNQHKLKAAICKLEPFPDLPEFQELRSVQNDLKYNSGTFTLRQEISHFLSMTPSDSLPLT
RLEGIRQLSQKLHDNKEDIRELLKECHAEPTNSILVKLVLNLLQLCKLATNHPTGVDILE
AAGSSLGELGPVNLSTIVLLHGRDPLYEKAMTIFPSTDSQCVYIILNCVNDSLTHQCIDV
RQAAAQSVNGILATQSGINFWEQHKQSRDPMLAYLNPFRKANKKVTTMSSEESLQAREKL
ENQDFWIPQIGGHTVWLKSLCAALLDSGGVKCEPLLLSRPLCLVNLDCCQRLLPLIIHSI
LLDDSQGSWRELLSTHIQDFFSFCSRSAQAASRSTTPLNLDSETDTASQGLYDKASLRTM
LAVIDYLRHQQRHLTSDSKPSGTVCDSNFWLDLNYLEVAKSAQSCSAHFTALLYTEIYVD
KIKSNLEDSRRTKGKATRKINFEENSQNLTISFLTEKSMEDSNISLQELLIDVYRSIGEP
DSLYGCGGETVTSPLTRIRTYEHESMWGKALTSYDLHSTLPDVTRQVGIVEGLQNFGLSS
ILTTYMRGLESEGVEWGAELRELRFQAAWRNTQWDCELSERSDKHKPGFHESVFCALQAL
RDKEFSMFDDTLKWARGREVEELCKGSLEAVSSLYPALRNLQSLGELESIKPLFARSFSE
LTVKNVHNQRKQHSQLLSNSDFALVEPILAIRSVSYNTLMSRTVDPDTTQYLSSVLTDHL
LELCQMARKAGHTQLAERAVFQMKQHGVEDPRSSSPISLWQLEEAQVFWVKGEQSLALGL
LKQMIQKLEEHVDFNPALAPIYTECLRLCGNWLAETCQESPGVILEKYLERAVEVIEVES
GVQDARLQNERIEAFLSLARFSDAQYQSIDKYMTSSEFENKQALLEKAKEEVDLMKERNV
IKNRYTIKVERELELDEKALSNLQADRQRFLCKAVENYIQCLEQGEEHDTWVFRLASLWL
ENADMTVVNDMMKKGVKKIPSYKFLPLMYQLAARMGTKMASGIREDVGFHDVLSELIFRS
CLEHPHHTLFIIFALVNANKDQQFCTSRLTKSAPRQSSPFDMERSNVAQKIISAVRKKRG
EMIRGIERLCDAYITLAYLDASRHKVEKKAIPIPADQPIHQIKDLDEVAIPTVELKVDPS
GRYDDVVTVHSFLPHYHLAGGVNLPKIIDCVGSDGKSRRQLVKGKDDLRQDAVMQQVFAM
CSMLLLRNTDTHKRKLNIRRYKVVPFSQCSGVLEWCSGTIPLGEYLADPVKGAHKRYRPQ
DASSLACRRKMMEAQKHGFDEKLQAYIEVCKNFKPVFRYFCMERFVDPAVWMEKRLAYTR
SVATSSIVGYIVGLGDRHIQNILIDEQTAELVHIDLGVAFEQGKILPTPETVPFRLSRDI
VDGMGITGVEGVFRRCCEKTMGVMRTYQEALLTIVEVLLYDPLFDWTMNPLKAFNLQHDE
QQELNATLSSTMGGDDLGNHNKHSDSQNFNKVAERVLLRLQEKLKGVEGGTVLSVGGQVN
LLIQQAMDHKNLSRLFPGWQAWV
NT seq 9252 nt   +upstreamnt  +downstreamnt
atgagtctggctctttctgatctcttggtgtgctgcaggggactagagaatgacaaggtt
acagagaggaagaaagaagctgaacgcttcagaaagctcatacgatctccagagattgtg
caagaacttgatcgtacctcggggccaaaaaccaaaggctccaaacaactcacatgggat
gctgttttcagatttctgcagcgatacctccaacgggagactgaaaccatgaaatcgagt
aaatccaacgtcacgaccacaacgctggccatccggcagaagaagatgtctgaaataagc
agtttgatcagattttttgtgtgctacgcaaacaaacgtgggcctcggctaaagtgcagt
gagctgctgaagcatgtgattgacgttcttcaaaattcatacagctgttcagcctttgga
aaagactacagcaacctgctcctcagggaaatcctgtctgttcgcaagtactggtgtgac
atcactccacagcagtggcacagtcttttagatgtgtacagccgcttgttcacctcctca
tccacatccattaaccgtgttcttgtaagtcgggtcatcaacacggtggtgcggggctgc
tgcatgcagactgatggattcaataaaaccttgttcagcttcttcgccaaggcattgctc
aatgcaaggcatgagaaacatttgactgttttggagcatgttatctcggcgcttaacacc
ttcttgaaagctgtggcaatgaactgtcggatgagggtgtgtcgactgggggaggaactg
cttccatcaatactgtatgtctgggccaacatgaggcccagtgctgctctcaaagaggaa
attgtggagttcttcaacttgcagctctgcatccatcatcccaaaggagcaaagacccag
gacacaggtgctcatgctgaggactgggccaggtggcgagatttgctgtacaacctctac
gaagcattagttaaagaaatcagtcagattgggagcagagggaagtatgtcactggcacg
agacatatcgccgtcaaagataacctcatcaagctcgcagctgatatttgtcaccagctt
ttcagtactgacgaagactctcagatctctgaggcaacgcaggcctcttccctgataact
agttccctttgtggaacaccaagcaagcgacgacgaattgacctcagttgggaggttctt
ttagaccgcctgcaacctcattgtagcgactttgatatcattccatggctacagatcaca
gaagcactcatatcgaattacccatcaatggtacccagccaagcgacagtcccactgtta
tcaatgttgcaccagctcttagctgaacaccggagaggagaaagggggctgtacgtgctg
cgctgtttacgcgaggtagcccgatgtcaagcccattttccagaaaggatcagagtttac
aagccagagctggacaaactttggagtcgtgtatggcctctgacactgcgccgtgtgagc
tcaccccagttagaagctctcagcctggacctactggtctccattgtccacggtggactg
gtcaatgtggatagagagttctggaagctcttctcaggatcggcatgtaaaccatcccag
agcgctgtgattggtctggcccaagctcttctgaagtgtccggtccctaaggatcatctg
ggagtcccagatggatcagggtcacttaacttgaaggaaaccctcattggctggttgttg
atgacagatcagagcgacgagatggaggataactccaggcctcatcccatcatttgcagc
gattttcctcacaatctaatagcaaacatcctggtctccttgaccgtgaaagacacctgt
gctggcctgaatttccttctcggttctgagggagtagagggtgctttttctcaagagtgc
acatccctcggtgttaatgaagatttggacaagattgagagattgtacttgcaatttagc
tttaacacggagttggcacaaagcagaggatctgacaagaagtccaaggtgacgtcagct
aatgggcacttcacggccatcggcggtctcaaaaagaagttggagcagtctcttctttgt
gtcgccgacaaccttcttaactgttcctttcctaacagtcagtccacaaccccagagtgc
ctgttgcgctgtttaagcctgctgacgggtgttcaagcaggttatgtctccacaggttgt
ctcactgaggatgaggcagagcgctcccagctattcacgaaagctaagaccctggctcag
gagttaagtggatttgtgtcgagcgtgaaagtgaagatgagtgaagaattaaccatgacc
acactgaggtctgtcattaggctatgcactattactgccacaacaaaaaacaaggaaaat
atttgcacattctcctctcgtcttttcataatgactctcccggcgagttttatcacagag
ctggcagagatttacaaaattatgcttagcagcgtttctccgagagcttcagttgtggat
aaagacgaacctacggataatgactgggaaatgaccagaacccagcatggagacgaccat
cctctattcgatgatgaggagttccacagtgggactcagagagcaaggggaggagacagc
aatgaaatgtcaagtggaccaggtgcaaaaagcctgttagctgatgagcatttagtccac
caggatcttgctctcctcgaaatcttggagttcttgtgtaagtgcggctcagttcagccc
gtccatggccaactttataaacctcaggaggtacgacgcaggctcttactgctggtggag
caaattgaccctagcaaagccctgcatgtcaacatgtatcttgtcctgttaaagaagctt
ccgactgaggactccctcactcccgaggagtttgactctctgcttcgtcctctggcggac
ttgtgttctctgtatcgtcaggatcaggagatgtgtgttgcacttcttgtggctttattg
ccctccatcaggagcttggggcgaacccacgatatgcaattggagatgaagcatgtgcag
ggctccctgctacaagtgctgtcagggttctgttacctgagccaaacggggaaatgcaca
gccactgtccgagttgctttggtgcaatgtctggttgcgctactggaggctgacccatgt
tgcaggtgggccatattgagtatcagggaggctgaaagagaggaagaccgtccagtgtct
gtcatccttccatctctccttgcggatccccatcaccaagtccgcatgcttgtggcaatg
tcattggaaaggctatttctggacatgagacccaagcacagagacgagagaaagatgttg
tcggaccaacaagcagcttttgagaacatttacttgaaagctcaagagggcatgacaccg
gtgaaaagcagctcaactgatgatgagcaggatgagattttcaaccgaaaggctaccttg
ctgaagagtttgtcagtcgtgctgtgttgtagtccagtctgcgagaagcagaccctgttt
gccctcttccagtcttacaaggaaaataatattgacgagcacctcattaagaagatgttg
tgtagcgtatccagaacacttggctacaacaagatgaaaacatttgtcagctctcacctg
tactacttggttgccgaatggctctcccagagacagtctgacgacagctacacgcttgaa
tctttccctttcactctacttgaccatggcacgctcaaagatttctatagctcctcatac
caggtgctcatcccgcaccttgtcttcctggatgactttgagcaagtgaagtctattggc
cggtatcttgagagggactggagagagcttctggctgactgtttccccaagatcatggtc
aacatcctaccatactttgcgctgtctggccaggagacagcacaacagagggagaaggcc
caccgtgtgtatgacctgctcaaagatgcaaactgtttgggcaaacagcaaattgacagc
ctgatccacagtaacctaccagagttagttgtcgaactgctaatgactctctatgaaagg
ggtgcctctgaagaggacagaggagacttgaaacgctttataggggaattggaccctgtc
ccaaacccaccatacttcagctctcaggtcatcaaagctacactggactatctgagcaaa
tgccacagctcaaaccacaagtccctggtggccattctgtcaaaaacgccaatatctatt
cagaggattcttctggcaatatgtgaaaaggccgctgtgacaactaacggttatgaacgt
catcgcatcctcctgatgtatcacctctttgtcaacctgctgctcagggaggtgaaagac
agtcttggaggagcctgggcttttgtcctcagggacatcatatacacactcatccaccat
atcaacagctggctggtgcatgcagacacacaaagaccaattcagtgtgatgaggtctcc
aagcgaagcttgtccctgtgctgtgacctcttgactgccgtgtgtcaggctgctctgcag
ttctgtgatgatgctctagactgccacctaaaggttattgttggtactctcactgcacaa
gtgaccagccagccagctatctcacagcaggtgctcagtctattgaaatttcttgtcata
aaaaatcaacacaaactgaaggcagccatttgcaagttggaaccgtttcctgacctgcct
gaattccaagagctgcgttctgtccagaacgatctcaaatacaattctgggaccttcaca
ttgagacaggagatatcacacttcctgtctatgacaccttctgactcattaccactgacc
agacttgagggaattcggcaactttcccaaaaactgcatgacaacaaagaagacataaga
gagttgcttaaagagtgccatgctgagcccacaaacagcatcctggtgaagctggttctg
aatctgctgcagctctgtaagctggcaaccaatcaccctactggagttgacattctagag
gcagcaggaagtagtctgggagaactggggcctgtaaatctctccaccatcgtcttgctc
cacggcagagatcctctttatgaaaaggctatgaccatcttcccttccactgactctcag
tgtgtttacatcatccttaactgcgtgaatgactccctcactcaccagtgtattgatgtg
aggcaggcagcagctcaatctgtgaatggcatccttgccacccagtccggaatcaacttt
tgggagcagcacaaacaaagtagagaccccatgttggcatacctaaatccatttagaaaa
gccaacaagaaggtgactactatgagttctgaagagagtttgcaggccagggagaagctg
gagaaccaagacttttggatcccacagataggcggccacacagtttggctgaagtctctg
tgtgctgccctgctggacagcggaggagtcaagtgtgagcctctcctactgtcccgacct
ctttgtctggtgaacttggactgttgccagaggctgttgcccctcatcatccattctatc
ctcctggatgacagtcagggctcctggagagagttgctctctacccatatccaagacttc
ttcagtttttgttcccgaagtgctcaggctgcgagccgctccaccacaccactcaacctt
gactccgagactgacaccgccagccaaggcttgtacgacaaggcatctctgcgtaccatg
ctcgccgttattgactatctgagacaccagcagagacacctgacatcggatagcaagcct
tctggcacagtgtgtgattccaacttctggctggacctgaactacttggaggtggccaaa
tctgctcagtcatgctctgctcacttcactgctctgctctacactgagatatatgtggat
aagattaaatcaaatttggaggacagtcgcagaacgaaaggcaaagcaacacgcaagatc
aactttgaagaaaacagccaaaatctcactatctccttcctgactgagaaaagtatggag
gactccaacatcagcttgcaggaactgctgattgatgtctaccggagcatcggcgagcct
gacagtctttatggctgtggaggagaaacagtgaccagtccactaacaaggattcgaaca
tacgagcatgaatctatgtggggaaaagctctgacttcatacgatcttcactcgaccctg
ccagatgtcactcgacaagtgggaattgtggagggcctgcagaactttggtctgagtagc
atcctcaccacctacatgaggggtctggagagtgaaggggtggagtggggagctgagctg
agggagctccgtttccaggctgcctggagaaacactcagtgggactgtgagctttctgag
aggagtgataaacacaagccgggcttccatgagtctgtgttctgcgccttgcaagcattg
agggacaaggagttctccatgtttgatgatactctaaaatgggcgaggggtagagaagta
gaggagctgtgtaaaggcagtctggaggcagtgtcctcactgtacccagcccttcggaac
ctgcagagcctcggggagctcgagagcatcaaacctctgttcgcaagatcattctcagag
ttgactgttaagaatgtgcataaccagaggaagcagcactcccagcttctctcaaacagc
gactttgctttggtggagcccatcttggccattcgttctgtgtcctacaacaccctgatg
tccaggacggtggaccccgacactactcagtatctcagctcagtgcttactgaccactta
ctggaactgtgccagatggctcggaaagcagggcacacacagttggcggagcgagcagtg
tttcagatgaagcagcatggagttgaagacccccgatcatcatcaccaatatcactttgg
caactggaagaagctcaggtgttttgggtgaagggagaacaaagtctggctctaggcctt
ctgaaacagatgatccagaagcttgaggaacatgttgacttcaatcctgctctggcaccg
atctacactgagtgcctcaggctctgtggtaactggcttgctgaaacgtgccaggaaagt
cctggagtcattttggagaagtacttggagagggctgttgaggtaattgaagttgaatcc
ggagtgcaggacgctcggcttcagaatgagcgaattgaggccttcctgtcgctggctcgt
ttttcagatgcccagtaccagagcattgataaatacatgacttcatccgagtttgagaat
aagcaggctttgctggaaaaggctaaagaagaagtggatctaatgaaagagcgtaacgta
ataaaaaacaggtatacaataaaggtagaacgagagctggagctggacgagaaggccctt
tccaacctgcaggcagacagacagcgcttcctgtgtaaggcagtagaaaactacatacag
tgtctggagcaaggtgaggagcacgacacatgggtgttccgtttggcgtcgctctggctg
gaaaatgctgacatgacagtagtcaatgacatgatgaagaaaggagtaaagaagatcccc
tcctacaagtttctacctcttatgtatcagcttgctgcgcgtatgggaaccaagatggcg
tctggcataagagaggacgtgggcttccatgacgtccttagtgaattgatcttccggtct
tgtcttgagcaccctcatcatacgttgttcatcatctttgccctggtcaacgccaacaag
gaccaacagttttgtactagtcggctgacgaagagtgctccacgtcagtcttcgccattt
gacatggagcgttccaatgtggcccagaagatcatcagtgccgtcaggaaaaagagaggc
gagatgatccggggtattgagcgactatgtgacgcttatatcacacttgcttatctggat
gccagcaggcacaaggtagagaagaaggcaattcccattcctgcggatcagccaatacat
caaatcaaagacctggatgaagttgcaattcccactgttgagctcaaggtcgatccttca
ggtcgctatgatgatgtagtgaccgtccattccttcctgcctcattatcacctggctgga
ggagtcaacctgcccaagatcatagactgcgtgggctcggatggcaagagcagaaggcaa
ctggtcaagggtaaagacgacttgcggcaagatgcggtcatgcagcaggtgtttgccatg
tgttccatgttgctgctgcggaacactgacactcacaagaggaagctcaatatcagaaga
tataaggtggtgccgttctctcagtgcagcggggtcttggaatggtgctccggtacgatt
cctcttggagaataccttgcggatcctgtcaaaggggctcacaaacgatacagaccgcag
gacgcttccagcctcgcctgccgcaggaagatgatggaggcacagaaacatggctttgac
gagaagctccaagcttacatcgaggtgtgcaaaaacttcaagcctgtgttcagatatttc
tgcatggaacgcttcgtggaccccgcagtgtggatggaaaagcggctggcctacacccgc
agcgtggccacttcctctatcgttggctatatcgttggcctcggtgaccggcacattcag
aacatcttaattgatgagcagactgccgagctggtgcatattgatttaggtgtggctttc
gagcaaggcaagattctgcccacccccgagaccgtccccttcagactctccagggatatt
gtcgatggaatgggcatcactggagtggagggagttttcaggagatgttgtgagaagacc
atgggggtaatgagaacctatcaagaagctttgctgaccatcgtggaggtgctgctctat
gaccccttgtttgactggaccatgaaccccctaaaagccttcaacctgcagcacgacgag
cagcaggagctcaacgccacactcagttcaaccatgggaggtgacgacttgggcaaccac
aataaacacagtgacagccagaacttcaacaaggtggcagagcgagtgctgctgcgactg
caagagaagttgaagggtgtggaggggggcacggtgctctccgtgggtggccaggtcaat
ctgctcatccaacaggccatggaccacaaaaacctcagcaggctcttcccaggctggcag
gcctgggtgtag

DBGET integrated database retrieval system