KEGG   Hippocampus comes (tiger tail seahorse): 109513644Help
Entry
109513644         CDS       T04969                                 

Gene name
mgst1
Definition
(RefSeq) microsomal glutathione S-transferase 1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq00480  Glutathione metabolism
hcq00980  Metabolism of xenobiotics by cytochrome P450
hcq00982  Drug metabolism - cytochrome P450
hcq00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    109513644 (mgst1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    109513644 (mgst1)
   00982 Drug metabolism - cytochrome P450
    109513644 (mgst1)
   00983 Drug metabolism - other enzymes
    109513644 (mgst1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hcq02000]
    109513644 (mgst1)
Enzymes [BR:hcq01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     109513644 (mgst1)
Transporters [BR:hcq02000]
 Other Transporters
  Pores ion channels [TC:1]
   109513644 (mgst1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG
Motif
Other DBs
NCBI-GeneID: 109513644
NCBI-ProteinID: XP_019721779
LinkDB All DBs
Position
Unknown
AA seq 151 aa AA seqDB search
MLELMQDEVFKAFSTYALIVILKMMLMSPLTTFYRFRKGSFATEEDVAFKPAEERKKLLR
THPDVERVRRCHLNDLENVLPFVLVGLFYALSGPELPAALLHFRIFAGSRIFHTISYVGA
FPQPCRALSFLVGLAATISMAYNTFSQVFVI
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgttggagctgatgcaagatgaggtgttcaaggctttcagcacctacgcacttatcgtc
atcctgaagatgatgcttatgtcacctttgactactttttaccgcttcaggaaagggtct
tttgccacggaggaggatgtggcctttaagcctgcggaagagagaaagaaactgctgaga
acccacccagatgtcgagcgagttcgtaggtgtcacctgaatgacttggaaaacgttctt
cccttcgtgctggtcggcttgttctacgccctgagtggaccggaactcccggccgccttg
cttcatttccggatctttgccggttctcggatcttccacaccatctcctacgtcggggct
tttcctcagccctgcagggctctgtcctttctcgtgggcttggcagccaccatttccatg
gcctacaacaccttcagtcaggttttcgtgatctga

DBGET integrated database retrieval system