KEGG   Hippocampus comes (tiger tail seahorse): 109513792
Entry
109513792         CDS       T04969                                 

Gene name
stat3
Definition
(RefSeq) signal transducer and activator of transcription 3 isoform X1
  KO
K04692  signal transducer and activator of transcription 3
Organism
hcq  Hippocampus comes (tiger tail seahorse)
Pathway
hcq04068  FoxO signaling pathway
hcq04217  Necroptosis
hcq04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:hcq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    109513792 (stat3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109513792 (stat3)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    109513792 (stat3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hcq03000]
    109513792 (stat3)
Transcription factors [BR:hcq03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    109513792 (stat3)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 AP1AR
Other DBs
NCBI-GeneID: 109513792
NCBI-ProteinID: XP_019722014
UniProt: A0A3Q2YQE5
LinkDB
Position
Unknown
AA seq 793 aa
MAQWNQLQQLETRYLEQLYHLYSDSFPMELRQFLAPWIESQDWTFAAKKESHATLVFHNL
LGEIDQQYSRFLQENNVLYQHNLRRIKQHLQSKYLEKPMDIARIVARCLWEEQRLLQTAT
AAAQDGQAAHPTGTVVTEKQQILEHNLQDIRKRVQDMEQKMKMLENLQDDFDFNYKTLKS
QGELNQDLNGNSQAAATRQKMAQLEQMLSTLDQLRRQIVTEMGGLLTAMDYVQKNLTDEE
LAEWKRRQQIACIGGPPNICLDRLETWITSLAESQLQIRQQIKKLEELQQKVSYKGDPIV
QHRPALEEKIVDLFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTNKVRLLVKFPELN
YQLKIKVCIDKESGDVAAIRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCG
NGGRTNSDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILW
YNMLTDQPKNVNFFTKPPVGTWDQVAEVLSWQFSSTTKRGLTIEQLTTLAEKLLGPSVNY
SGCQFTWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILS
PKPPGTFLLRFSESSKEGGITFTWVEKDINGKTQIQSVEPYTKQQLNNMSFADIIMGYKI
MDATNILVSPLVYLYPEIPKEEAFGKYCRPEAAPEPELGDSTSIIQPYLKTKFICVTPCP
SVFMDFPDSELLGNGFPGTNSGNTSDLFSLSLSPRTLDSLMPNEAEANPGHLESLTLDMD
VASPMHVNPSNLV
NT seq 2382 nt   +upstreamnt  +downstreamnt
atggcccagtggaaccagttgcaacagctggagaccaggtacctggagcagctgtaccac
ctgtacagcgacagcttccccatggagctgcggcagttcctcgcgccctggattgaaagt
caggactggactttcgccgctaagaaggagtctcatgccaccctggtgttccataatctc
ctgggcgagatagaccagcagtacagccgcttcctgcaggagaacaacgtcctctaccag
cacaacctgaggcggatcaagcagcacctgcagagcaagtacctggagaagcccatggac
atcgcccgtatcgtcgctcgctgcttgtgggaggagcaacggctgctacagacggccacc
gctgctgcgcaggacggacaagccgcccaccccacagggacagtggtgacagagaagcag
cagattctggaacacaaccttcaagacatcaggaaacgagtgcaggacatggaacagaag
atgaagatgctggagaacctgcaggacgactttgatttcaactacaagacattgaaaagc
caaggagagctgaaccaggacctgaacgggaatagccaggcagcagctaccaggcaaaaa
atggctcagctggagcagatgctgagtaccctggaccagctcagacggcaaattgtgaca
gagatgggaggcttactgaccgcaatggactacgtacagaagaacctgacagacgaagaa
ctggccgaatggaagcgacgacagcaaatcgcctgcatcggaggtccgccgaacatctgc
cttgaccgcctggaaacatggatcacgtccttagctgagtcccagctccagattcggcag
cagatcaagaaactggaagagcttcaacaaaaggtgtcgtacaagggagaccccattgtc
cagcaccggcccgcactcgaggagaagattgtggacttgttcagaaacctcatgaagagt
gcgtttgtggtagaaagacagccgtgcatgcccatgcacccagacagaccattggtcatc
aaaacaggcgtgcagttcacaaacaaagtcaggctgcttgtgaagtttcctgagctcaat
taccagctgaaaattaaagtttgcattgacaaggagtctggggacgtggctgcaatcaga
gggtccagaaagttcaacatcctcggcactaacaccaaagtcatgaacatggaggagtcc
aacaacggcagcttgtcggcagagtttaaacacttgaccctcagagagcagcggtgtggt
aacggtggacgcaccaatagtgacgcatctcttatcgtcaccgaggagctccatctgatc
acctttgagactgaagtctatcaccaaggcctgaagattgatctggagacgcattcgctc
cccgtagtggtcatatctaacatctgccagatgccaaatgcctgggcgtccatcttgtgg
tacaacatgctcaccgatcagccaaagaatgtgaacttcttcaccaaaccgccagtgggg
acgtgggaccaggtggctgaagtgctcagctggcaattctcgtccaccacaaagagaggc
ctgaccattgagcaactcaccacactggccgagaaactgttagggccgtctgtcaactac
tcaggctgtcagtttacgtgggccaagttctgtaaggagaatatggccggtaaaggcttt
tctttctgggtctggctagacaacatcatcgacctggtcaagaagtacatccttgcgctg
tggaatgaggggtacatcatgggctttatcagcaaggagagagagagggccattcttagc
cccaaaccgccgggcacgtttcttctgcgcttcagtgagagcagcaaggaaggcggcatc
acgttcacgtgggttgagaaagatatcaacggcaaaactcagattcagtcggtggagcca
tacaccaagcagcaactcaacaacatgtctttcgccgatatcatcatgggctacaaaatc
atggatgccaccaacatcctggtttcccccctcgtgtatctgtatcccgaaattcccaag
gaggaagccttcgggaagtactgtcgaccggaggctgctcctgaacccgagctgggagac
tccacaagtatcattcagccgtacttgaagaccaagttcatctgcgttaccccgtgtccc
tccgtgttcatggactttccggacagtgagctgcttgggaacggattcccggggacaaac
tcgggcaacaccagcgaccttttctcactctcactgtctccgcgcactctggactcgctg
atgcccaatgaagcggaggctaatccaggacatctggaatccctgactctggacatggat
gtagcttctcccatgcatgtgaacccatccaacttggtttga

DBGET integrated database retrieval system